DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn1 and PDZK1

DIOPT Version :9

Sequence 1:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster
Sequence 2:XP_024303384.1 Gene:PDZK1 / 5174 HGNCID:8821 Length:539 Species:Homo sapiens


Alignment Length:343 Identity:75/343 - (21%)
Similarity:119/343 - (34%) Gaps:93/343 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IPQQHSPS-PSGLRCGNMETRVRGAWYRVLVTLETDFLAVSL---------------DESCEAAQ 66
            :.::.||: .:||:.|:...|:.|    |.|..|.....|.|               |...:|.:
Human    57 VVEKCSPAEKAGLQDGDRVLRING----VFVDKEEHMQVVDLVRKSGNSVTLLVLDGDSYEKAVK 117

  Fly    67 PSND----GQSTT---LNGTLGSNHSGGG---------------GGGAGGGGTGGGGQNGTLPNS 109
            ...|    |||..   |:..:.|....||               ||..|.......|:.|.....
Human   118 TRVDLKELGQSQKEQGLSDNILSPVMNGGVQTWTQPRLCYLVKEGGSYGFSLKTVQGKKGVYMTD 182

  Fly   110 ASLQGMNIQ------DTELDGSASN-DNGDRDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHV-- 165
            .:.||:.::      |..::.:..| ::...:..:.....:|......:.|    ....||||  
Human   183 ITPQGVAMRAGVLADDHLIEVNGENVEDASHEEVVEKVKKSGSRVMFLLVD----KETDKRHVEQ 243

  Fly   166 ------------------RII--KSDNNGLGISIKGGRENRMPILISKIFRGMAADQAKGLYVGD 210
                              ||:  |..:||.|..::.|.|.:..| |..|..|..|::| ||...|
Human   244 KIQFKRETASLKLLPHQPRIVEMKKGSNGYGFYLRAGSEQKGQI-IKDIDSGSPAEEA-GLKNND 306

  Fly   211 AILTVNGEELRDATHDEAVRALKRSG-----RVVDLEVKFLREVTPYFRKASIISEVGWELQRAF 270
            .::.||||.:....||..|..:::.|     .|||      :|....:|.|.....:.::.|.  
Human   307 LVVAVNGESVETLDHDSVVEMIRKGGDQTSLLVVD------KETDNMYRLAHFSPFLYYQSQE-- 363

  Fly   271 LCPLGPGVPTSPPAPKTT 288
               |..|.....|||..|
Human   364 ---LPNGSVKEAPAPTPT 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622 9/45 (20%)
PDZ_signaling 163..244 CDD:238492 31/107 (29%)
PHsplit_syntrophin <293..351 CDD:269960
PDZK1XP_024303384.1 PDZ_signaling 27..107 CDD:238492 12/53 (23%)
PDZ 152..232 CDD:214570 10/79 (13%)
PDZ_signaling 261..340 CDD:238492 25/80 (31%)
PDZ 395..475 CDD:214570
F1-ATPase_gamma <457..>501 CDD:320933
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.