DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn1 and Pdzd3

DIOPT Version :9

Sequence 1:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_001178925.1 Gene:Pdzd3 / 500986 RGDID:1559807 Length:498 Species:Rattus norvegicus


Alignment Length:284 Identity:56/284 - (19%)
Similarity:96/284 - (33%) Gaps:84/284 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 IKSDNNGLGISIK--GGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVR 230
            |:....|.|..::  .|.:.|:...:.::..|:.||:| |:..||.::.|.||.:....|:|.|.
  Rat   266 IEKGPQGFGFLLREEKGPDGRLGQFLWEVDPGLPADKA-GMKAGDRLVAVAGESMDGLGHEETVS 329

  Fly   231 ALKRSGRVVDLEVKFLREVTPYFRKASIISEVGWELQRAF-LCPLGPGVPTSPPAPKTTPRADTR 294
            .::..|..|.|.|     |.|             |..|.| :..|.|.:..........|.|:|:
  Rat   330 RIRAQGSCVSLVV-----VDP
-------------EADRFFSMVRLSPLLFLENTEIAAAPLAETK 376

  Fly   295 YIPLQLTHLARNLKYIDP-----ENRCFELHSPDGVHSCILRAADSAEALVWFNALHSAMGTSTQ 354
            .:|::.|        ::|     ..:||....|.|.:...||...|...|               
  Rat   377 DLPVEDT--------VEPSGLAGSRQCFLYPGPGGGYGFRLRCVASGPCL--------------- 418

  Fly   355 RALAEANRALTNLIGELKHIGWLSKRMSGGGSSGSAG----------GGAASGGSGTSNSVVAGE 409
                                  ...:::.|||:..||          .|...||....:::....
  Rat   419 ----------------------FISQVTPGGSAARAGLQMGDAILEVNGCPVGGDSDLDTLQQLA 461

  Fly   410 LVSPSGR--SSSESSDESDKWLPI 431
            ...|..|  .:..:|..|:.|:.:
  Rat   462 EAEPPLRLKLAPRNSQGSEAWISL 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622
PDZ_signaling 163..244 CDD:238492 21/77 (27%)
PHsplit_syntrophin <293..351 CDD:269960 12/62 (19%)
Pdzd3NP_001178925.1 PDZ_signaling 47..127 CDD:238492
PDZ_signaling 155..232 CDD:238492
PDZ 260..345 CDD:214570 23/84 (27%)
PDZ_signaling 407..472 CDD:238492 14/101 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.