DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn1 and dysc

DIOPT Version :9

Sequence 1:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_001261810.1 Gene:dysc / 39533 FlyBaseID:FBgn0264006 Length:1254 Species:Drosophila melanogaster


Alignment Length:364 Identity:81/364 - (22%)
Similarity:126/364 - (34%) Gaps:118/364 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ESSSLGR-----TPPAAQQPIPQQHSPSPSGLRCGNMETRVRGAWYRVLVTLETDFLAVSLDESC 62
            |:..:|.     :||....|.... |.:..|.|.||..:.:|||..|                  
  Fly    92 EAEDIGMAFGMISPPPGSGPYVGS-SAAAGGSRVGNSTSSLRGAGGR------------------ 137

  Fly    63 EAAQPSNDGQSTTLNGTLGSNH----SGG---GGGGAGGGGTG----------GGGQNGTLPNSA 110
            .....|..|.|.|:.....|.|    |.|   .||...|.|:.          ..|..||||.|.
  Fly   138 SGLYYSPPGTSYTIVERPHSPHYYFNSAGVPTKGGSLPGRGSAYLSSSPASHMAAGTAGTLPTST 202

  Fly   111 SLQGMNIQDTELDGSASNDNGDRDPCLN------------------NNNNAGDGGGMDM------ 151
            :..|.::      |..::.||::...::                  ::.:..:||..|.      
  Fly   203 AASGRSM------GQHASSNGNKKRPISPEQVLRMFGATQSSSVPTSSYHYSNGGTRDRDRTGRR 261

  Fly   152 --CDVPDHVANQKRHVRIIKSD----------------------NNGLGISIKGGRENRMPILIS 192
              ...|....:|....|..:.|                      ::|.||.:|||:::.:.:.||
  Fly   262 SPASSPPSTTHQIYRDRERERDRSVPNIHELTTRTVSMSRDQQIDHGFGICVKGGKDSGLGVYIS 326

  Fly   193 KIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRVVDLEVKFLREVTPYFRKAS 257
            :|.....|::| ||..||.||.|||.......|:|   ||||..::    :|..|:::...|...
  Fly   327 RIEENSVAERA-GLRPGDTILEVNGTPFTSINHEE---ALKRCVQI----LKSSRQISMTVRAPP 383

  Fly   258 IISEVGWELQRAFLCPL-GPGVPTSPP-----APKTTPR 290
            .::..         .|| |.|.|:..|     ||...|:
  Fly   384 TLNST---------APLHGFGPPSRDPMYASMAPPLHPQ 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622 7/30 (23%)
PDZ_signaling 163..244 CDD:238492 28/102 (27%)
PHsplit_syntrophin <293..351 CDD:269960
dyscNP_001261810.1 PDZ_signaling 294..380 CDD:238492 28/93 (30%)
PDZ_signaling 466..543 CDD:238492
HN_L-whirlin_R2_like 573..653 CDD:259823
PDZ_signaling 886..971 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.