DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn1 and Zasp66

DIOPT Version :9

Sequence 1:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster


Alignment Length:168 Identity:36/168 - (21%)
Similarity:64/168 - (38%) Gaps:45/168 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 RIIKSDNNGLGISIKGGRENRMPILISKIFRGMAADQAKG-LYVGDAILTVNGEELRDATHDEAV 229
            |:..:|...:|:.:                    ...|.| |..||.|..:...:.||.:|.:|.
  Fly    57 RVHFADEQNVGVQV--------------------GSPAHGELLRGDIISKIGEYDARDLSHADAQ 101

  Fly   230 RALKRSGRVVDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTP----- 289
            :..:.:|..:.|.|....::. |.:.|:         |.|     |||..::...|..||     
  Fly   102 QLFRGAGNEIRLVVHRDNKIA-YTQGAT---------QEA-----GPGSRSNSTLPPVTPDLMPH 151

  Fly   290 RADTRYIPLQLTHLARNLKY-ID--PENRCFELHSPDG 324
            |..:.::| ..:|..|.|:. :|  |:....:|:|..|
  Fly   152 RGPSPFLP-GPSHFERALQLPVDTLPQTVFPQLNSSGG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622
PDZ_signaling 163..244 CDD:238492 15/78 (19%)
PHsplit_syntrophin <293..351 CDD:269960 9/35 (26%)
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 12/66 (18%)
DUF4749 285..359 CDD:292558
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.