DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn1 and inaD

DIOPT Version :9

Sequence 1:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster


Alignment Length:335 Identity:74/335 - (22%)
Similarity:115/335 - (34%) Gaps:117/335 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SPSGLRCGNMET----------RVRGAWYRVLVTL--ETDF---LAVSLDESCEAAQPSNDGQST 74
            ||:.| ||.::.          .||.:..:.::.|  |.||   |.:...:..:..|..:|.:| 
  Fly    69 SPAHL-CGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQTFDKSDEQQAKSDPRS- 131

  Fly    75 TLNG------------TLGSNHSGGGGGGAG-GGGTGGGGQNGTLPNSASLQGMNI--------- 117
              ||            |..:|.|||.|.|.| |.|.|..|.|    ...|:|..|.         
  Fly   132 --NGYMQAKNKFNQEQTTNNNASGGQGMGQGQGQGQGMAGMN----RQQSMQKRNTTFTASMRQK 190

  Fly   118 ---------QDT-------------ELD-GSASN-----DNGDRDPCLNNNNNAGDGGGMDMCDV 154
                     :||             |:| .||.|     ...|||      ....|..|..|..:
  Fly   191 HSNYADEDDEDTRDMTGRIRTEAGYEIDRASAGNCKLNKQEKDRD------KEQEDEFGYTMAKI 249

  Fly   155 PDHVANQK--RHVRIIKSDNNGLGISIKGGRE-NRMPILISKIFRGMAADQAKG---LYVGDAIL 213
            .......|  |.:.:.:..:..||:::.|.:: .:|...::    |:..:.|.|   :..||.|:
  Fly   250 NKRYNMMKDLRRIEVQRDASKPLGLALAGHKDRQKMACFVA----GVDPNGALGSVDIKPGDEIV 310

  Fly   214 TVNGEELRDATH-------------------------DE--AVRALKRSGRVVDLEVKFLREVTP 251
            .|||..|::..|                         ||  .|:.:|:.....| |.||:.:..|
  Fly   311 EVNGNVLKNRCHLNASAVFKNVDGDKLVMITSRRKPNDEGMCVKPIKKFPTASD-ETKFIFDQFP 374

  Fly   252 YFRKASIISE 261
            ..|...:..|
  Fly   375 KARTVQVRKE 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622 9/45 (20%)
PDZ_signaling 163..244 CDD:238492 22/111 (20%)
PHsplit_syntrophin <293..351 CDD:269960
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492 12/46 (26%)
PDZ_signaling 259..340 CDD:238492 16/84 (19%)
PDZ_signaling 377..457 CDD:238492 2/8 (25%)
PDZ_signaling 500..584 CDD:238492
PDZ_signaling 597..672 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.