Sequence 1: | NP_001262192.1 | Gene: | Syn1 / 40424 | FlyBaseID: | FBgn0037130 | Length: | 627 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001137648.1 | Gene: | CG42319 / 36473 | FlyBaseID: | FBgn0259219 | Length: | 452 | Species: | Drosophila melanogaster |
Alignment Length: | 198 | Identity: | 45/198 - (22%) |
---|---|---|---|
Similarity: | 77/198 - (38%) | Gaps: | 34/198 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 129 DNGDRDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGISIKGGRENRMPILISK 193
Fly 194 IFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRVVDLEVKFLREVTPYFR---- 254
Fly 255 -KASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPLQLTHLARNLKYID--PENRC 316
Fly 317 FEL 319 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Syn1 | NP_001262192.1 | PH-like | 30..>61 | CDD:302622 | |
PDZ_signaling | 163..244 | CDD:238492 | 20/80 (25%) | ||
PHsplit_syntrophin | <293..351 | CDD:269960 | 8/29 (28%) | ||
CG42319 | NP_001137648.1 | PDZ_signaling | 45..119 | CDD:238492 | 21/82 (26%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |