DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn1 and Whrn

DIOPT Version :9

Sequence 1:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster
Sequence 2:XP_038965801.1 Gene:Whrn / 313255 RGDID:631330 Length:969 Species:Rattus norvegicus


Alignment Length:280 Identity:73/280 - (26%)
Similarity:116/280 - (41%) Gaps:48/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 ANQKRHVRIIKSDNNGLGISIKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDA 223
            :..::.|.::..|...||::|:||.|..:.|.|:.:..|..| ::.||.|||.||.|||......
  Rat   273 SGDEKKVNLVLGDGRSLGLTIRGGAEYGLGIYITGVDPGSEA-ESSGLKVGDQILEVNGRSFLSI 336

  Fly   224 THDEAVRALKRSGRVVDLEVKFLREVTPYFR------KASIISEVGWELQRAFLCPLG------- 275
            .|||||:.||.|..:: |.||.:..: |:.|      |....|.:|..:..:...| |       
  Rat   337 LHDEAVKLLKSSRHLI-LTVKDVGRL-PHARTTVDQTKWIASSRIGESITNSAGFP-GDLTEEGT 398

  Fly   276 --PGVPTSPPAPKTTPRA---DTRYIPLQLTHLARNLKYIDPENRCFELHSPDGVHSCILRAADS 335
              ||....|...:.|..:   .||.:   |...||:|  :..:.|...::..|......:    |
  Rat   399 NKPGFYKGPAGSQVTLSSLGNQTRAL---LDDQARHL--LTEQERATMMYYLDQYRGGTI----S 454

  Fly   336 AEALVWFNALHSAMGTSTQRALAEANRALTNL--IGELKH------IGWLSKRMSGGGSSGS--- 389
            .||||.  ||...:.|..:.:|....|.:.:.  :....|      |..:..|...|...|.   
  Rat   455 VEALVM--ALFELLNTHAKFSLLSEVRGIISPQDLDRFDHLVLRREIESMKARQPPGPGVGDTYS 517

  Fly   390 ----AGGGAASGGSGTSNSV 405
                :..|:::|..|||.:|
  Rat   518 MVSYSDTGSSTGSHGTSTTV 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622
PDZ_signaling 163..244 CDD:238492 31/80 (39%)
PHsplit_syntrophin <293..351 CDD:269960 15/57 (26%)
WhrnXP_038965801.1 HN_L-whirlin_R1_like 38..113 CDD:259822
PDZ_signaling 139..216 CDD:238492
PDZ_signaling 276..356 CDD:238492 31/81 (38%)
HN_L-whirlin_R2_like 418..498 CDD:259823 19/90 (21%)
PDZ_signaling <908..949 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.