DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn1 and Grip2

DIOPT Version :9

Sequence 1:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster
Sequence 2:XP_006506166.1 Gene:Grip2 / 243547 MGIID:2681173 Length:1049 Species:Mus musculus


Alignment Length:333 Identity:76/333 - (22%)
Similarity:119/333 - (35%) Gaps:102/333 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 GSASND----NGDRDPCLNNNNNAGDGGGMDMC---DVPDHVANQKRHVRIIKSDNNGLGISIKG 181
            |:|.:|    .|.:|       .||..|.: :|   .:|:....... |.:||.:.:.||::|.|
Mouse    22 GTARDDGPYSKGGKD-------TAGADGAL-VCRRQSIPEEFRGITM-VELIKREGSTLGLTISG 77

  Fly   182 GRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRVVDLEVKFL 246
            |.:......:|.:..|..|.::..|.|||.|.:|||..|....|||.:..||..|..|.|||:: 
Mouse    78 GTDKDGKPRVSNLRPGGLAARSDLLNVGDYIRSVNGIHLTRLRHDEIITLLKNVGERVVLEVEY- 141

  Fly   247 REVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPLQL----------- 300
                              ||              .||||:..||..::.:.:.|           
Mouse   142 ------------------EL--------------PPPAPENNPRIISKTVDVSLYKEGNSFGFVL 174

  Fly   301 -------THLARN--LKYIDPENRC---------FELHSPDGVHSCILRAADSAEALVWF-NALH 346
                   .|.:|.  |.|:.|....         ..|.|.||:.   |..|..|.|:... ...|
Mouse   175 RGGAHEDLHKSRPLVLTYVRPGGPADREGSLKVGDRLLSIDGIP---LHGASHATAIATLQQCSH 236

  Fly   347 SAM-----GTSTQRALAEANRALTNLIGELKHIGWLSKRMSGGGSSGSAGGGAASGGSGTSNSVV 406
            .|:     ..:|...:|.|:..|...|.:               :.|||.|.:.:.||..:...:
Mouse   237 EALFQVEYDVATPDTVANASGPLVVEIAK---------------TPGSALGISLTTGSHRNKPAI 286

  Fly   407 AGELVSPS 414
            ..:.:.|:
Mouse   287 TIDRIKPA 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622
PDZ_signaling 163..244 CDD:238492 29/80 (36%)
PHsplit_syntrophin <293..351 CDD:269960 16/92 (17%)
Grip2XP_006506166.1 PDZ_signaling 58..140 CDD:238492 29/82 (35%)
PDZ_signaling 160..243 CDD:238492 16/85 (19%)
PDZ_signaling 258..341 CDD:238492 9/52 (17%)
PDZ_signaling 463..551 CDD:238492
PDZ_signaling 564..647 CDD:238492
PDZ_signaling 664..744 CDD:238492
PDZ_signaling 947..1026 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.