DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Syn1 and LNX2

DIOPT Version :9

Sequence 1:	NP_001262192.1	Gene:	Syn1 / 40424	FlyBaseID:	FBgn0037130	Length:	627	Species:	Drosophila melanogaster
Sequence 2:	NP_699202.1	Gene:	LNX2 / 222484	HGNCID:	20421	Length:	690	Species:	Homo sapiens

Alignment Length:	107	Identity:	32/107 - (29%)
Similarity:	57/107 - (53%)	Gaps:	10/107 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly   153 DVPDHVANQKRHVRIIKSDNNGLGISIKGGRENR---MPILISKI-FRGMAADQAKGLYVGDAIL 213
            |:...|..|::|:.:.|..:..||:::.|||.::   :||.::.: ..|..|...: :..||.:|
Human   457 DLTQCVTCQEKHITVKKEPHESLGMTVAGGRGSKSGELPIFVTSVPPHGCLARDGR-IKRGDVLL 520

  Fly   214 TVNGEELRDATHDEAVRALKRSG-----RVVDLEVKFLREVT 250
            .:||.:|.:.:|.|||..||.|.     .:..|||:.:.|.|
Human   521 NINGIDLTNLSHSEAVAMLKASAASPAVALKALEVQIVEEAT 562

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Syn1	NP_001262192.1	PH-like	30..>61	CDD:302622
		PDZ_signaling	163..244	CDD:238492	26/89 (29%)
		PHsplit_syntrophin	<293..351	CDD:269960
LNX2	NP_699202.1	mRING-HC-C3HC3D_LNX2	45..89	CDD:319694
		modified RING-HC finger (C3HC3D-type)	50..87	CDD:319694
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	198..224
		NPXY motif	208..211
		PDZ	230..316	CDD:214570
		PDZ	336..422	CDD:214570
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	418..455
		PDZ_signaling	466..542	CDD:238492	23/76 (30%)
		PDZ_signaling	599..683	CDD:238492
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810