DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn1 and txt-1

DIOPT Version :9

Sequence 1:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_493661.1 Gene:txt-1 / 183651 WormBaseID:WBGene00016807 Length:152 Species:Caenorhabditis elegans


Alignment Length:166 Identity:33/166 - (19%)
Similarity:70/166 - (42%) Gaps:34/166 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GTLPNSASLQGMNIQDTELDGSASNDNGDRDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRII 168
            |:.|.::.|:  :::||:.|.:.:.|:       .|:.|:|.         .|| ..::..|.::
 Worm     5 GSAPPNSKLK--SVEDTDDDRTLAEDD-------QNDQNSGS---------MDH-RFERIKVTLM 50

  Fly   169 KSDNNGLGISIKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDA--THDEAVRA 231
            .:.....|:.|....:.   ||:.|:......  |..|..||.|:.:|.:.:.:.  .....::.
 Worm    51 MTQGKKFGLGIVSVHQR---ILVCKVENESLV--AGVLKYGDQIIEINKKNVLNKIDCKKRLMQC 110

  Fly   232 LKRSGRVVDLEVKFLREVTPYFRKASIISEVGWELQ 267
            ||..|:|   ::..:|..|     |..::.:..|:|
 Worm   111 LKDKGQV---DIIIVRPKT-----ADAVTMIEQEIQ 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622
PDZ_signaling 163..244 CDD:238492 16/82 (20%)
PHsplit_syntrophin <293..351 CDD:269960
txt-1NP_493661.1 PDZ_signaling 45..>100 CDD:238492 12/59 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.