DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn1 and T19B10.5

DIOPT Version :9

Sequence 1:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_505852.3 Gene:T19B10.5 / 179553 WormBaseID:WBGene00011833 Length:596 Species:Caenorhabditis elegans


Alignment Length:358 Identity:72/358 - (20%)
Similarity:111/358 - (31%) Gaps:125/358 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 WYRVLVTL-ETDFLAVSLDESCEAAQPSNDGQSTTLNGTLGSNHSGGGGGGAGGGGTGGGGQNGT 105
            |||...|: |||..:...:::|:......|.                                  
 Worm    55 WYRRSSTIRETDEKSAYANDACDVEDKGCDA---------------------------------- 85

  Fly   106 LPNSASLQGMNIQDTELDGSASNDNGDRD----PCLNNNNNAGDGGGMDMCDVPDHVANQKRHVR 166
             |.|.:...|.:.|:........|:|.:.    ..||              :|...|..|.|.| 
 Worm    86 -PKSINKDKMTMIDSFKLKRKMEDSGTQKAYSMEFLN--------------EVEGKVGVQLRGV- 134

  Fly   167 IIKSDNNGLGISIKGGRENRMPILISKIFRGMAADQAKGLYVGDAI--LTVNGEELRDATHDEAV 229
                |..|||.:|:|....  .|.:.:|.....|:|...:.|||.|  ||:|.|.:   .:::||
 Worm   135 ----DIGGLGFNIQGNMNE--GIFVKEIISKGIAEQCGNILVGDKIKSLTINFENM---VYEDAV 190

  Fly   230 ----------------RALKRSGRVVDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGV 278
                            |.|..|..|.|.:........|.||..:        |......||  |.
 Worm   191 TLLSYSSPYKVKLELERKLSDSASVSDSDDDKEMRYHPLFRSNT--------LTHVHFNPL--GT 245

  Fly   279 PTSPPAPKTTPRADTRYIPLQLTHLARNLKYIDPEN-RCFELHS----------------PDGVH 326
            .::|.:..|||:..|.....|...|....:.|:|:: .|.:.:|                .||:.
 Worm   246 ISTPTSIATTPQRCTSTDSKQKHALPPQREIIEPDSTTCADDNSQARDADNSRMDSSDYGSDGIS 310

  Fly   327 SCILRAADSAEALVWFNALHSAMGTSTQRALAE 359
            .|                ..|.....||:.|::
 Worm   311 DC----------------RESTASDGTQKTLSD 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622 7/19 (37%)
PDZ_signaling 163..244 CDD:238492 27/98 (28%)
PHsplit_syntrophin <293..351 CDD:269960 11/74 (15%)
T19B10.5NP_505852.3 PDZ 137..208 CDD:214570 19/75 (25%)
PTZ00449 <340..483 CDD:185628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.