DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn1 and cytip

DIOPT Version :9

Sequence 1:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster
Sequence 2:XP_003199223.2 Gene:cytip / 100537036 ZFINID:ZDB-GENE-140106-76 Length:343 Species:Danio rerio


Alignment Length:337 Identity:72/337 - (21%)
Similarity:126/337 - (37%) Gaps:87/337 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 NSASLQGMNIQDTELDGSASNDNGDRDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDN 172
            |:..::|..:..::|..:.||                        .:.|:...|:..|.:.|.||
Zfish    46 NTEGMKGRTLSQSQLARTHSN------------------------SLVDYTDPQRTMVVLEKQDN 86

  Fly   173 -------NGLGISIKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVR 230
                   ...|:.:|......|...:.::..|.||:.| ||..||.||:|||..:..:||...:.
Zfish    87 EVFGFEVQTYGLKVKNTSMVEMCTFVCRVQDGSAAETA-GLTAGDIILSVNGVSIEGSTHQNIIE 150

  Fly   231 ALKRSGRVVDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRY 295
            .::.|...:.||..          ..|::..:..|.:..:|              |.|.|  .::
Zfish   151 LIRESSNTLKLETV----------SGSVMKRIELEKKMHYL--------------KQTLR--EKW 189

  Fly   296 IPLQ--------LT--HLARNLKYIDPENRCFELHSPDG--------VHSCILRAADSAEALVWF 342
            :.||        ||  :|..:.:|:..:: ...|.||.|        ..||.....|.:|...: 
Zfish   190 VELQSLTLKEKRLTQGNLNESAQYLSVDS-VMSLSSPMGRSGQRFSSDSSCRSIMTDDSEDGAF- 252

  Fly   343 NALHSAMGTSTQRALAEANRALTNL-IGELKHIGWLSKRMSGGGSSGSAGGGAASGGSGTSNSVV 406
              :.|....|:..:..|::.:...| :|.|:.| ..::.:|..||:.|     .|.|..||.|.:
Zfish   253 --MSSVFDDSSPLSPIESSGSFFQLEVGALRPI-TRTRSISLTGSNSS-----LSPGWETSPSSL 309

  Fly   407 AGELVSPSGRSS 418
            .|.|...|.:.|
Zfish   310 FGTLPRRSRKGS 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622
PDZ_signaling 163..244 CDD:238492 25/87 (29%)
PHsplit_syntrophin <293..351 CDD:269960 15/75 (20%)
cytipXP_003199223.2 PDZ_signaling 78..162 CDD:238492 23/84 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.