DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn1 and whrna

DIOPT Version :9

Sequence 1:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster
Sequence 2:XP_002665968.3 Gene:whrna / 100334777 ZFINID:ZDB-GENE-091118-27 Length:939 Species:Danio rerio


Alignment Length:311 Identity:79/311 - (25%)
Similarity:115/311 - (36%) Gaps:88/311 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PSGLRCGNMETRVRGAWYRVLVTLETDFLA--VSLDESCEAAQPSNDGQSTTLNGTLGSN----- 83
            |.|.:.|...:...||          :|.|  |:|..|.::...|:|| :.||...||.|     
Zfish   117 PDGAQEGANSSPTHGA----------NFPASQVALRGSPDSISTSSDG-TATLIPLLGRNFLPEP 170

  Fly    84 -----------HSGGGGGGAG--GGGTGGGG------QNGTLPNSASL----QGMNIQDTELDGS 125
                       |....|.|..  ||...|.|      :.|:|.....|    |.|.:.|...|..
Zfish   171 PGEIRQVILKRHKSNEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKEGLRMGDQIMKVNDKVFDRV 235

  Fly   126 ASND-----NGDRDPCL--------------NNNNNAGDGGGMDMCDVPDHVANQK--------- 162
            ...|     .|.:..|:              |:.....|..|..:...||.:|..:         
Zfish   236 THADAVKVLKGSKKLCMSVRSVGRIPGGYITNHVYTWVDPQGRSVSPPPDLLAEHRSATLRRSNS 300

  Fly   163 --------------RHVRIIKSDNNGLGISIKGGRENRMPILISKIFRGMAADQAKGLYVGDAIL 213
                          :.|.::..|...||:.|:||.|..:.|.|:.:.||.|| :..|:.|||.||
Zfish   301 QGRSHMQLLQDGDEKKVNLVLDDGRSLGLMIRGGAEYSLGIYITGVDRGSAA-ECGGIKVGDQIL 364

  Fly   214 TVNGEELRDATHDEAVRALKRSGRVVDLEVKFLREVTPYFRKASIISEVGW 264
            .|||.......||||||.||.|..:: :.||.:..: |:.|  :::.|..|
Zfish   365 EVNGRSFLSIPHDEAVRVLKSSHHLM-MTVKDVGRL-PHTR--TVVGETKW 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622 7/32 (22%)
PDZ_signaling 163..244 CDD:238492 32/80 (40%)
PHsplit_syntrophin <293..351 CDD:269960
whrnaXP_002665968.3 HN_L-whirlin_R1_like 25..102 CDD:259822
PDZ_signaling 174..255 CDD:238492 17/80 (21%)
PDZ_signaling 314..394 CDD:238492 32/81 (40%)
HN_L-whirlin_R2_like 459..538 CDD:259823
PDZ_signaling 848..919 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.