DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINK6 and Fs

DIOPT Version :10

Sequence 1:NP_995313.2 Gene:SPINK6 / 404203 HGNCID:29486 Length:80 Species:Homo sapiens
Sequence 2:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster


Alignment Length:33 Identity:14/33 - (42%)
Similarity:20/33 - (60%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    48 CGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC 80
            ||.||:||.:.|...:.|.|.|..|::.:||.|
  Fly   655 CGVDGKTYRSACDINRMICKIGRSIAVAYPGPC 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINK6NP_995313.2 Kazal_1 36..80 CDD:395004 13/31 (42%)
FsNP_652376.2 KAZAL 564..604 CDD:197624
KAZAL_FS 654..687 CDD:238052 13/31 (42%)
KAZAL_FS 723..767 CDD:238052
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.