DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14568 and CG14569

DIOPT Version :9

Sequence 1:NP_649355.1 Gene:CG14568 / 40418 FlyBaseID:FBgn0037124 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_649354.1 Gene:CG14569 / 40417 FlyBaseID:FBgn0037123 Length:195 Species:Drosophila melanogaster


Alignment Length:172 Identity:67/172 - (38%)
Similarity:88/172 - (51%) Gaps:40/172 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLIAAMAAVSVAEPTRFRGRFSRLQFARQEQAPGDQAVPADPAVDIAPTPASAPYPPAGVTPEVP 74
            :|:.::.|:|.|||  .|.||    .|||              |:..|:|:...||.||:||.||
  Fly    11 ILVLSLLALSSAEP--IRRRF----LARQ--------------VEAIPSPSPTGYPEAGITPSVP 55

  Fly    75 FDLPTETEAQPDLTYGPPDEPDNTYGPPDNTYGPPAEPENTYGPPADGPVDQ-APAADPVPAGLI 138
            ||||:.| .:|:.||.|   ||||||||||||||   |:||||||....|.. ||.|:|:|...|
  Fly    56 FDLPSST-VKPENTYLP---PDNTYGPPDNTYGP---PDNTYGPPETDSVPAIAPEAEPLPENPI 113

  Fly   139 Q----PRNERL----LSRRPTPEKLRSAQ----IIRSGSVLV 168
            :    |..|..    ...:|..|.....:    :...|:|:|
  Fly   114 ETDDIPETEEASVDGAKLQPADEDAEEDEPQLDVAEDGTVIV 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14568NP_649355.1 DUF4794 61..119 CDD:292661 36/57 (63%)
CG14569NP_649354.1 DUF4794 42..105 CDD:292661 41/69 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014348
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.