DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb8 and NRPB8A

DIOPT Version :9

Sequence 1:NP_649352.1 Gene:Rpb8 / 40415 FlyBaseID:FBgn0037121 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_175827.1 Gene:NRPB8A / 841866 AraportID:AT1G54250 Length:146 Species:Arabidopsis thaliana


Alignment Length:144 Identity:69/144 - (47%)
Similarity:101/144 - (70%) Gaps:3/144 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLFEDIFNVKDMDPEGKKFDRVSRLHCESESFKMDLILDINSWLYPMELGDKFRLVLATTLREDG 68
            :||||||.|..:||:|||||:|:|:...|.:.:|.:.||:|:.:||:.:||||.|.||.||..||
plant     6 ILFEDIFVVDQLDPDGKKFDKVTRVQATSHNLEMFMHLDVNTEVYPLAVGDKFTLALAPTLNLDG 70

  Fly    69 CPDSGEYNPMEHEGTRADSFEYVMYGKIYRIEGDEAHNEASRLSAYVSFGGLLMRLQGDANNLHG 133
            .||:|.:.|...: |.||.:||:|:||:|:|  .|...:..:...|||||||||.|:||..::..
plant    71 TPDTGYFTPGAKK-TLADKYEYIMHGKLYKI--SERDGKTPKAELYVSFGGLLMLLKGDPAHISH 132

  Fly   134 FEVDQHMYLLMKRL 147
            ||:||.::|||::|
plant   133 FELDQRLFLLMRKL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb8NP_649352.1 RPOL8c 2..146 CDD:197821 68/141 (48%)
NRPB8ANP_175827.1 RNA_pol_Rpb8 12..144 CDD:397790 62/134 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 136 1.000 Domainoid score I1601
eggNOG 1 0.900 - - E1_KOG3400
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4540
Inparanoid 1 1.050 141 1.000 Inparanoid score I1783
OMA 1 1.010 - - QHG53918
OrthoDB 1 1.010 - - D1504067at2759
OrthoFinder 1 1.000 - - FOG0004425
OrthoInspector 1 1.000 - - otm3070
orthoMCL 1 0.900 - - OOG6_102056
Panther 1 1.100 - - O PTHR10917
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3136
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.