DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb8 and polr2h

DIOPT Version :9

Sequence 1:NP_649352.1 Gene:Rpb8 / 40415 FlyBaseID:FBgn0037121 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001017600.1 Gene:polr2h / 550263 ZFINID:ZDB-GENE-050417-66 Length:150 Species:Danio rerio


Alignment Length:150 Identity:116/150 - (77%)
Similarity:134/150 - (89%) Gaps:1/150 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGVLFEDIFNVKDMDPEGKKFDRVSRLHCESESFKMDLILDINSWLYPMELGDKFRLVLATTLR 65
            |||:||||||:|||:||:||||||||||||||||||||||||:|..:||::||||||||:|:||.
Zfish     1 MAGILFEDIFDVKDIDPDGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLY 65

  Fly    66 EDGCPDSGEYNPMEHEGTRADSFEYVMYGKIYRIEGDEAHNE-ASRLSAYVSFGGLLMRLQGDAN 129
            |||.||.|||||.:...:|||.|:||||||:|||||||...| |:|||||||:||||||||||||
Zfish    66 EDGTPDDGEYNPQDDRPSRADQFDYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDAN 130

  Fly   130 NLHGFEVDQHMYLLMKRLAF 149
            ||||||||..:|||||:|||
Zfish   131 NLHGFEVDSRVYLLMKKLAF 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb8NP_649352.1 RPOL8c 2..146 CDD:197821 111/144 (77%)
polr2hNP_001017600.1 RPOL8c 2..147 CDD:197821 111/144 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577549
Domainoid 1 1.000 228 1.000 Domainoid score I2432
eggNOG 1 0.900 - - E1_KOG3400
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4540
Inparanoid 1 1.050 244 1.000 Inparanoid score I3281
OMA 1 1.010 - - QHG53918
OrthoDB 1 1.010 - - D1504067at2759
OrthoFinder 1 1.000 - - FOG0004425
OrthoInspector 1 1.000 - - oto38718
orthoMCL 1 0.900 - - OOG6_102056
Panther 1 1.100 - - LDO PTHR10917
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1177
SonicParanoid 1 1.000 - - X3136
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.