DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb8 and polr2h

DIOPT Version :9

Sequence 1:NP_649352.1 Gene:Rpb8 / 40415 FlyBaseID:FBgn0037121 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001016113.1 Gene:polr2h / 548867 XenbaseID:XB-GENE-491773 Length:150 Species:Xenopus tropicalis


Alignment Length:150 Identity:115/150 - (76%)
Similarity:133/150 - (88%) Gaps:1/150 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGVLFEDIFNVKDMDPEGKKFDRVSRLHCESESFKMDLILDINSWLYPMELGDKFRLVLATTLR 65
            |||:||||||:|||:||||:||||||||||||||||||||||:|..:||::||||||||:|:||.
 Frog     1 MAGILFEDIFDVKDIDPEGRKFDRVSRLHCESESFKMDLILDVNIQVYPVDLGDKFRLVIASTLY 65

  Fly    66 EDGCPDSGEYNPMEHEGTRADSFEYVMYGKIYRIEGDEAHNE-ASRLSAYVSFGGLLMRLQGDAN 129
            |||..|.|||||.:...:|||.|||:||||:|||||||...| |:|||||||:||||||||||||
 Frog    66 EDGTLDDGEYNPTDDRPSRADQFEYIMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDAN 130

  Fly   130 NLHGFEVDQHMYLLMKRLAF 149
            ||||||||..:|||||:|||
 Frog   131 NLHGFEVDSRVYLLMKKLAF 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb8NP_649352.1 RPOL8c 2..146 CDD:197821 110/144 (76%)
polr2hNP_001016113.1 RNA_pol_Rpb8 8..147 CDD:367703 105/138 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 224 1.000 Domainoid score I2498
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4540
Inparanoid 1 1.050 240 1.000 Inparanoid score I3264
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1504067at2759
OrthoFinder 1 1.000 - - FOG0004425
OrthoInspector 1 1.000 - - oto104821
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1177
SonicParanoid 1 1.000 - - X3136
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.