DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb8 and POLR2H

DIOPT Version :9

Sequence 1:NP_649352.1 Gene:Rpb8 / 40415 FlyBaseID:FBgn0037121 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001265627.1 Gene:POLR2H / 5437 HGNCID:9195 Length:175 Species:Homo sapiens


Alignment Length:134 Identity:89/134 - (66%)
Similarity:105/134 - (78%) Gaps:10/134 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGVLFEDIFNVKDMDPEGKKFDRVSRLHCESESFKMDLILDINSWLYPMELGDKFRLVLATTLR 65
            |||:||||||:|||:|||||||||||||||||||||||||||:|..:||::||||||||:|:||.
Human     1 MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLY 65

  Fly    66 EDGCPDSGEYNPMEHEGTRADSFEYVMYGKIYRIEGDEAHNEAS----RLSA------YVSFGGL 120
            |||..|.|||||.:...:|||.||||||||:|||||||...||:    ||.|      .::..||
Human    66 EDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLLRLRAAEWQCSRITGWGL 130

  Fly   121 LMRL 124
            |.:|
Human   131 LFQL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb8NP_649352.1 RPOL8c 2..146 CDD:197821 88/133 (66%)
POLR2HNP_001265627.1 RPOL8c 2..>106 CDD:197821 79/103 (77%)
Non-specific ssDNA binding 16..40 23/23 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144442
Domainoid 1 1.000 226 1.000 Domainoid score I2531
eggNOG 1 0.900 - - E1_KOG3400
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4540
Inparanoid 1 1.050 242 1.000 Inparanoid score I3341
Isobase 1 0.950 - 0 Normalized mean entropy S652
OMA 1 1.010 - - QHG53918
OrthoDB 1 1.010 - - D1504067at2759
OrthoFinder 1 1.000 - - FOG0004425
OrthoInspector 1 1.000 - - oto91039
orthoMCL 1 0.900 - - OOG6_102056
Panther 1 1.100 - - LDO PTHR10917
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1177
SonicParanoid 1 1.000 - - X3136
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.