DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb8 and Polr2h

DIOPT Version :9

Sequence 1:NP_649352.1 Gene:Rpb8 / 40415 FlyBaseID:FBgn0037121 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001128261.1 Gene:Polr2h / 498109 RGDID:1561203 Length:150 Species:Rattus norvegicus


Alignment Length:150 Identity:117/150 - (78%)
Similarity:133/150 - (88%) Gaps:1/150 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGVLFEDIFNVKDMDPEGKKFDRVSRLHCESESFKMDLILDINSWLYPMELGDKFRLVLATTLR 65
            |||:||||||:|||:|||||||||||||||||||||||||||:|..:||::||||||||:|:||.
  Rat     1 MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLY 65

  Fly    66 EDGCPDSGEYNPMEHEGTRADSFEYVMYGKIYRIEGDEAHNE-ASRLSAYVSFGGLLMRLQGDAN 129
            |||..|.|||||.:...:|||.||||||||:|||||||...| |:|||||||:||||||||||||
  Rat    66 EDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDAN 130

  Fly   130 NLHGFEVDQHMYLLMKRLAF 149
            ||||||||..:|||||:|||
  Rat   131 NLHGFEVDSRVYLLMKKLAF 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb8NP_649352.1 RPOL8c 2..146 CDD:197821 112/144 (78%)
Polr2hNP_001128261.1 RPOL8c 2..147 CDD:197821 112/144 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338152
Domainoid 1 1.000 226 1.000 Domainoid score I2437
eggNOG 1 0.900 - - E1_KOG3400
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4540
Inparanoid 1 1.050 242 1.000 Inparanoid score I3244
OMA 1 1.010 - - QHG53918
OrthoDB 1 1.010 - - D1504067at2759
OrthoFinder 1 1.000 - - FOG0004425
OrthoInspector 1 1.000 - - oto98134
orthoMCL 1 0.900 - - OOG6_102056
Panther 1 1.100 - - LDO PTHR10917
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3136
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.