DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb8 and rpb8

DIOPT Version :9

Sequence 1:NP_649352.1 Gene:Rpb8 / 40415 FlyBaseID:FBgn0037121 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_595915.1 Gene:rpb8 / 2539794 PomBaseID:SPBC14C8.12 Length:125 Species:Schizosaccharomyces pombe


Alignment Length:143 Identity:57/143 - (39%)
Similarity:83/143 - (58%) Gaps:22/143 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLFEDIFNVKDMDPEGKKFDRVSRLHCESESFKMDLILDINSWLYPMELGDKFRLVLATTLREDG 68
            ||.::||.|..:|.:  |:.||||:...|....|:|.|||||.:||:|....|.|.:.:.|..  
pombe     5 VLLDEIFTVTSVDKQ--KYQRVSRITAVSGQNDMNLTLDINSQIYPLEKDATFSLQITSNLNS-- 65

  Fly    69 CPDSGEYNPMEHEGTRADSFEYVMYGKIYRIEGDEAHNEASRLSAYVSFGGLLMRLQGDANNLHG 133
             ||..|            :.:|:||||:||:|  ||.:|  ::|.|||||||||.::|....|:.
pombe    66 -PDLKE------------AADYIMYGKVYRVE--EAKDE--KVSVYVSFGGLLMAIEGSHRKLYR 113

  Fly   134 FEVDQHMYLLMKR 146
            ..:| |:|||::|
pombe   114 LSLD-HVYLLLRR 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb8NP_649352.1 RPOL8c 2..146 CDD:197821 56/141 (40%)
rpb8NP_595915.1 RPOL8c 3..125 CDD:197821 56/141 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2187
eggNOG 1 0.900 - - E1_KOG3400
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I1768
OMA 1 1.010 - - QHG53918
OrthoFinder 1 1.000 - - FOG0004425
OrthoInspector 1 1.000 - - oto101795
orthoMCL 1 0.900 - - OOG6_102056
Panther 1 1.100 - - LDO PTHR10917
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1177
SonicParanoid 1 1.000 - - X3136
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.