DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11247 and ZNF561

DIOPT Version :9

Sequence 1:NP_001097659.1 Gene:CG11247 / 40414 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_024307548.1 Gene:ZNF561 / 93134 HGNCID:28684 Length:502 Species:Homo sapiens


Alignment Length:349 Identity:105/349 - (30%)
Similarity:160/349 - (45%) Gaps:39/349 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 GEQDSKDDDYVQPQLK--KSARKGEPVKRKHHVCSQCSKEFGGKTDLQRHMLIHSDERPHKCKDC 126
            |...|:.:.|.:..|.  |.|..|:.:.:    .:.|.|.|.....|..|:.:.:..:|:|||:|
Human   158 GGNTSEGNCYGKDTLSVHKEASTGQELSK----FNPCGKVFTLTPGLAVHLEVLNARQPYKCKEC 218

  Fly   127 GKSYRQAVNLKNHI-----------------TTAHEHRKQFVC----------SQCPKSFALKER 164
            ||.::...:|.||:                 .||..|.||.|.          .:|.|||....:
Human   219 GKGFKYFASLDNHMGIHTDEKLCEFQEYGRAVTASSHLKQCVAVHTGKKSKKTKKCGKSFTNFSQ 283

  Fly   165 LRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVHMER 229
            |...::.|.|||.:.|..|.:.|.....|..|:..|  |.|:...||.|..:|:.:..|..|:..
Human   284 LYAPVKTHKGEKSFECKECGRSFRNSSCLNDHIQIH--TGIKPHKCTYCGKAFTRSTQLTEHVRT 346

  Fly   230 HEQGMEHRCSICENQFANELALRAHINQEHHKLTQFECEICHKMIEPDEDLATHMQRHTAVKTHV 294
            |.....:.|..|...||....|..|| :.|.....::|:.|.|.......|..|.:.||..|.:.
Human   347 HTGIKPYECKECGQAFAQYSGLSIHI-RSHSGKKPYQCKECGKAFTTSTSLIQHTRIHTGEKPYE 410

  Fly   295 CEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVA 359
            |..|...|...|:.:.|::.|:||:|:.|:||.:.|.:||.|.:|:|.|||||||.|:.|..  |
Human   411 CVECGKTFITSSRRSKHLKTHSGEKPFVCKICGKAFLYSSRLNVHLRTHTGEKPFVCKECGK--A 473

  Fly   360 FSQLAHLKNHMKKIHKQQKPYMCE 383
            |:..:.|..| ::||..:|||.|:
Human   474 FAVSSRLSRH-ERIHTGEKPYECK 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 48/185 (26%)
C2H2 Zn finger 95..115 CDD:275368 5/19 (26%)
zf-H2C2_2 107..132 CDD:290200 9/24 (38%)
C2H2 Zn finger 123..144 CDD:275368 9/37 (24%)
C2H2 Zn finger 152..172 CDD:275368 5/29 (17%)
zf-H2C2_2 165..189 CDD:290200 8/23 (35%)
C2H2 Zn finger 180..200 CDD:275368 5/19 (26%)
COG5048 <192..369 CDD:227381 58/176 (33%)
C2H2 Zn finger 210..230 CDD:275370 6/19 (32%)
C2H2 Zn finger 238..260 CDD:275371 7/21 (33%)
C2H2 Zn finger 267..287 CDD:275368 5/19 (26%)
C2H2 Zn finger 295..315 CDD:275368 5/19 (26%)
zf-H2C2_2 309..332 CDD:290200 9/22 (41%)
C2H2 Zn finger 323..343 CDD:275368 9/19 (47%)
C2H2 Zn finger 351..374 CDD:275368 6/22 (27%)
C2H2 Zn finger 382..399 CDD:275368 1/2 (50%)
ZNF561XP_024307548.1 KRAB 56..96 CDD:307490
C2H2 Zn finger 190..207 CDD:275370 5/16 (31%)
C2H2 Zn finger 215..235 CDD:275368 8/19 (42%)
C2H2 Zn finger 243..263 CDD:275368 6/19 (32%)
COG5048 <287..483 CDD:227381 65/200 (33%)
C2H2 Zn finger 299..319 CDD:275368 5/19 (26%)
C2H2 Zn finger 327..347 CDD:275368 6/19 (32%)
C2H2 Zn finger 355..375 CDD:275368 7/20 (35%)
C2H2 Zn finger 383..403 CDD:275368 5/19 (26%)
C2H2 Zn finger 411..431 CDD:275368 5/19 (26%)
C2H2 Zn finger 439..459 CDD:275368 9/19 (47%)
C2H2 Zn finger 467..487 CDD:275368 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.