DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11247 and ZNF878

DIOPT Version :9

Sequence 1:NP_001097659.1 Gene:CG11247 / 40414 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_016882684.1 Gene:ZNF878 / 729747 HGNCID:37246 Length:567 Species:Homo sapiens


Alignment Length:387 Identity:115/387 - (29%)
Similarity:182/387 - (47%) Gaps:59/387 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KHHVCSQCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFVCSQC 155
            |.:.|.:|.|.|...:.::||..|||.::|::||.|||::....:::.| ...|..:|.:.|.||
Human   177 KPYECKECGKAFRFPSSVRRHERIHSAKKPYECKQCGKAFSFPSSVRRH-ERIHSAKKPYECKQC 240

  Fly   156 PKSFALKERLRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVSH-------------------- 200
            .|:.:.....:.|||:|:||:|:.|::|.|.|.....|::|..||                    
Human   241 GKALSYLVSFQTHMRMHTGERPHKCNICGKAFFSPSSLKRHEKSHTGEKRYKCKQCDKAFNCPSS 305

  Fly   201 ---HK---TSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICENQFANELALRAHINQEH 259
               |:   :..:.:.||:|..:|.:...||||..:|.....:.|.:|...|.:..:.|.| .:.|
Human   306 FQYHERTHSGEKPYECTQCRKAFRSVKYLRVHERKHTGEKPYECKLCGKGFISSTSFRYH-EKTH 369

  Fly   260 HKLTQFECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCR 324
            .....:||:.|.|.....:||..|.:.||..|...|:.|...||..:.::.|.|.||||:||:|:
Human   370 TGEKPYECKKCVKAFSFVKDLRIHERTHTGEKPFECKQCGKTFTSSNSFHYHERTHTGEKPYECK 434

  Fly   325 ICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHDFF 389
            .|.:.|..:|||:.|||.||||||:.|:.|..  .|...:.||.| ::.|..:|||.|:.|...|
Human   435 QCGKAFRSASVLQKHIRTHTGEKPYGCKQCGK--VFRVASQLKMH-ERTHTGEKPYECKQCGKAF 496

  Fly   390 ----KIKVELQSHV-------EHCAKCPVD------------GDKP-----SGNQSEDAQIL 423
                .|:...::|.       :.|.|..:.            |:||     .|.....|.||
Human   497 ISSNSIRYHKRTHTGEKPYKCKQCGKAFISSNSFLYHERIHTGEKPYECKQCGKAFRSASIL 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 51/181 (28%)
C2H2 Zn finger 95..115 CDD:275368 6/19 (32%)
zf-H2C2_2 107..132 CDD:290200 11/24 (46%)
C2H2 Zn finger 123..144 CDD:275368 6/20 (30%)
C2H2 Zn finger 152..172 CDD:275368 7/19 (37%)
zf-H2C2_2 165..189 CDD:290200 11/23 (48%)
C2H2 Zn finger 180..200 CDD:275368 6/19 (32%)
COG5048 <192..369 CDD:227381 62/202 (31%)
C2H2 Zn finger 210..230 CDD:275370 8/19 (42%)
C2H2 Zn finger 238..260 CDD:275371 5/21 (24%)
C2H2 Zn finger 267..287 CDD:275368 6/19 (32%)
C2H2 Zn finger 295..315 CDD:275368 6/19 (32%)
zf-H2C2_2 309..332 CDD:290200 11/22 (50%)
C2H2 Zn finger 323..343 CDD:275368 9/19 (47%)
C2H2 Zn finger 351..374 CDD:275368 6/22 (27%)
C2H2 Zn finger 382..399 CDD:275368 4/20 (20%)
ZNF878XP_016882684.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.