DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11247 and Zfp639

DIOPT Version :9

Sequence 1:NP_001097659.1 Gene:CG11247 / 40414 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001155290.1 Gene:Zfp639 / 67778 MGIID:1915028 Length:485 Species:Mus musculus


Alignment Length:357 Identity:92/357 - (25%)
Similarity:151/357 - (42%) Gaps:73/357 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EEEDDGGE--QDSKDDDYVQPQLK--KSARKGEPVKRKHHVCSQCSKEFGGKTDLQRHMLIHSDE 118
            |.|::..|  ||..|:   :|..|  |...||:.:    :|.:|           |:..|:.::.
Mouse   154 EAENNSSESLQDQADE---EPPAKLCKILDKGQAL----NVTAQ-----------QKWPLLRANS 200

  Fly   119 RP-HKCKDCGKSYRQAVNLKNHITTAHEHRKQFVCSQCPKSFALKERLRLHMRLHSGEKPYPCDL 182
            .. :||:.|..:.:...:||.|:...|:.....||..|.:||:....|..|.:||. |.||.|..
Mouse   201 SGLYKCELCEFNSKYFSDLKQHVILKHKRTDSNVCRVCKESFSTNMLLIEHAKLHE-EDPYICKY 264

  Fly   183 CDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICENQFAN 247
            ||.|......|.||:...| .|...:.|.:|...||:::.|.:|.:.|.:..::.|..||::..:
Mouse   265 CDYKTVIFENLSQHIADTH-FSDHLYWCEQCDVQFSSSSELYLHFQEHSRDEQYLCQFCEHETGD 328

  Fly   248 ELALRAHINQEH----------------------HKLT------QFECEICHKMIEPDEDLATHM 284
            ...|.:|:..||                      .|:|      .|.|::|...    ..|.|::
Mouse   329 PEDLHSHVVNEHARRLIELSDKCGSGGHGQCSLLSKITFDKCKNFFVCQVCGFR----SRLHTNV 389

  Fly   285 QRHTAVK-----THVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIR-KH 343
            .||.|::     .|||:.|...|:...:|..|:..|..|..|.|:.|..:......||:|:. ||
Mouse   390 NRHVAIEHTKIFPHVCDDCGKGFSSMLEYCKHLNSHLSEGIYLCQYCEYSTGQIDDLKIHLDFKH 454

  Fly   344 TGEKPFRCQLC------EDEVAFSQLAHLKNH 369
            :.:.|.:|..|      |.::    |.||:.|
Mouse   455 SADLPHKCSECLMRFGNERDL----LGHLQVH 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 42/159 (26%)
C2H2 Zn finger 95..115 CDD:275368 3/19 (16%)
zf-H2C2_2 107..132 CDD:290200 5/25 (20%)
C2H2 Zn finger 123..144 CDD:275368 5/20 (25%)
C2H2 Zn finger 152..172 CDD:275368 6/19 (32%)
zf-H2C2_2 165..189 CDD:290200 11/23 (48%)
C2H2 Zn finger 180..200 CDD:275368 7/19 (37%)
COG5048 <192..369 CDD:227381 53/216 (25%)
C2H2 Zn finger 210..230 CDD:275370 6/19 (32%)
C2H2 Zn finger 238..260 CDD:275371 7/43 (16%)
C2H2 Zn finger 267..287 CDD:275368 4/19 (21%)
C2H2 Zn finger 295..315 CDD:275368 5/19 (26%)
zf-H2C2_2 309..332 CDD:290200 6/22 (27%)
C2H2 Zn finger 323..343 CDD:275368 5/20 (25%)
C2H2 Zn finger 351..374 CDD:275368 7/25 (28%)
C2H2 Zn finger 382..399 CDD:275368
Zfp639NP_001155290.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..80
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..136
C2H2 Zn finger 235..255 CDD:275368 6/19 (32%)
C2H2 Zn finger 262..283 CDD:275368 7/20 (35%)
C2H2 Zn finger 291..307 CDD:275368 5/15 (33%)
Interaction with CTNNA2. /evidence=ECO:0000250 371..455 24/87 (28%)
C2H2 Zn finger 376..397 CDD:275368 7/24 (29%)
C2H2 Zn finger 405..425 CDD:275368 5/19 (26%)
zf-C2H2_8 408..481 CDD:406359 21/76 (28%)
C2H2 Zn finger 433..454 CDD:275368 5/20 (25%)
C2H2 Zn finger 462..482 CDD:275368 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7392
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.