DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11247 and ZFP69B

DIOPT Version :9

Sequence 1:NP_001097659.1 Gene:CG11247 / 40414 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_005271193.1 Gene:ZFP69B / 65243 HGNCID:28053 Length:535 Species:Homo sapiens


Alignment Length:342 Identity:101/342 - (29%)
Similarity:156/342 - (45%) Gaps:53/342 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ESSPGPTLAIKRRKSSLASLRDACVDEEEDDGGEQDSKDDDYVQPQLKKSARKGEPVKRKHHVCS 96
            |..||| :.:.|::           |.:.|..|::...:.|.|.       ......|.|...|:
Human   238 EVMPGP-IGLPRKR-----------DRKYDTPGKRSRYNIDLVN-------HSRSYTKMKTFECN 283

  Fly    97 QCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFVCSQCPKSFAL 161
            .|.|.|.....|..||.||:.|:|.:||:|||::.|:.:|..| ...|...|.:.|.:|.|:|..
Human   284 ICEKIFKQLIHLTEHMRIHTGEKPFRCKECGKAFSQSSSLIPH-QRIHTGEKPYECKECGKTFRH 347

  Fly   162 KERLRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVH 226
            ...|..|:|:|:|||||.|.:|:|.|::...|.||:.:|.:.  :.|.|..|..:|....:||.|
Human   348 PSSLTQHVRIHTGEKPYECRVCEKAFSQSIGLIQHLRTHVRE--KPFTCKDCGKAFFQIRHLRQH 410

  Fly   227 MERHEQGMEHRCSICENQFANELALRAHINQEHHKLTQFECEICHKMIEPDEDLATHMQRHTAVK 291
            ...|.....:.|::|...|::..           .|||                  |.:.||..:
Human   411 EIIHTGVKPYICNVCSKTFSHST-----------YLTQ------------------HQRTHTGER 446

  Fly   292 THVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCED 356
            .:.|:.|...|:|:...::|.|:|||.:||:|..|.:.|.|.|....|.|.||||||:.|..|..
Human   447 PYKCKECGKAFSQRIHLSIHQRVHTGVKPYECSHCGKAFRHDSSFAKHQRIHTGEKPYDCNECGK 511

  Fly   357 EVAFSQ--LAHLKNHMK 371
            ..:.|.  :.|.|.|::
Human   512 AFSCSSSLIRHCKTHLR 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 55/158 (35%)
C2H2 Zn finger 95..115 CDD:275368 7/19 (37%)
zf-H2C2_2 107..132 CDD:290200 12/24 (50%)
C2H2 Zn finger 123..144 CDD:275368 8/20 (40%)
C2H2 Zn finger 152..172 CDD:275368 7/19 (37%)
zf-H2C2_2 165..189 CDD:290200 13/23 (57%)
C2H2 Zn finger 180..200 CDD:275368 7/19 (37%)
COG5048 <192..369 CDD:227381 50/178 (28%)
C2H2 Zn finger 210..230 CDD:275370 6/19 (32%)
C2H2 Zn finger 238..260 CDD:275371 3/21 (14%)
C2H2 Zn finger 267..287 CDD:275368 1/19 (5%)
C2H2 Zn finger 295..315 CDD:275368 6/19 (32%)
zf-H2C2_2 309..332 CDD:290200 10/22 (45%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
C2H2 Zn finger 351..374 CDD:275368 6/23 (26%)
C2H2 Zn finger 382..399 CDD:275368
ZFP69BXP_005271193.1 SCAN <2..40 CDD:383046
KRAB 74..134 CDD:214630
COG5048 <194..430 CDD:227381 64/213 (30%)
C2H2 Zn finger 258..274 CDD:275368 3/22 (14%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..330 CDD:275368 8/20 (40%)
C2H2 Zn finger 338..358 CDD:275368 7/19 (37%)
C2H2 Zn finger 366..386 CDD:275368 7/19 (37%)
C2H2 Zn finger 394..414 CDD:275368 6/19 (32%)
C2H2 Zn finger 422..442 CDD:275368 7/48 (15%)
zf-H2C2_2 434..459 CDD:372612 9/42 (21%)
C2H2 Zn finger 450..470 CDD:275368 6/19 (32%)
zf-H2C2_2 462..487 CDD:372612 10/24 (42%)
C2H2 Zn finger 478..498 CDD:275368 7/19 (37%)
zf-H2C2_2 490..515 CDD:372612 10/24 (42%)
C2H2 Zn finger 506..526 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.