DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11247 and ZNF410

DIOPT Version :9

Sequence 1:NP_001097659.1 Gene:CG11247 / 40414 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001229853.1 Gene:ZNF410 / 57862 HGNCID:20144 Length:516 Species:Homo sapiens


Alignment Length:375 Identity:83/375 - (22%)
Similarity:138/375 - (36%) Gaps:143/375 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RSRRSVSKEDAVSLLTDSGISLSSPPAARESSPGPTLAIKRRKSSLASLRDACV---DEEEDDGG 64
            :|...:|..::.|||.|          .:.|.....:.:...::.|.|..:..|   ||.||.|.
Human   113 KSPEFLSTSESSSLLQD----------LQPSDSTSFILLNLTRAGLGSSAEHLVFVQDEAEDSGN 167

  Fly    65 E-----------------QDSKDDDYV---QPQLKKSAR---KGEPVKRKHHVCS--QCSKEFGG 104
            :                 |:...|..:   :.||.|:|:   .||.|    |:.|  ..||:.|.
Human   168 DFLSSESTDSSIPWFLRVQELAHDSLIAATRAQLAKNAKTSSNGENV----HLGSGDGQSKDSGP 228

  Fly   105 KTDLQRHMLIHSDERPHKC--KDCGKSYRQAVNLKNHITTAHEHRKQFVC--SQCPKSFALKERL 165
            ...:::.:         ||  :.|.:::....:.|.|:.| |.:.:.|:|  ..|.|||.:.:||
Human   229 LPQVEKKL---------KCTVEGCDRTFVWPAHFKYHLKT-HRNDRSFICPAEGCGKSFYVLQRL 283

  Fly   166 RLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVHMERH 230
            ::|||.|:||||:.|                    |::.        |...|:|..||:      
Human   284 KVHMRTHNGEKPFMC--------------------HESG--------CGKQFTTAGNLK------ 314

  Fly   231 EQGMEHRCSICENQFANELALRAHINQEHHKLTQFECEICHKMIEPDEDLATHMQRHTAVKTHVC 295
                                                               .|.:.||..|..:|
Human   315 ---------------------------------------------------NHRRIHTGEKPFLC 328

  Fly   296 EV--CNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKH 343
            |.  |...|.:.|....|:.:|:||:|:||::|.:||:.|....:|:|||
Human   329 EAQGCGRSFAEYSSLRKHLVVHSGEKPHQCQVCGKTFSQSGSRNVHMRKH 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 36/164 (22%)
C2H2 Zn finger 95..115 CDD:275368 4/21 (19%)
zf-H2C2_2 107..132 CDD:290200 3/26 (12%)
C2H2 Zn finger 123..144 CDD:275368 5/22 (23%)
C2H2 Zn finger 152..172 CDD:275368 10/21 (48%)
zf-H2C2_2 165..189 CDD:290200 10/23 (43%)
C2H2 Zn finger 180..200 CDD:275368 1/19 (5%)
COG5048 <192..369 CDD:227381 30/154 (19%)
C2H2 Zn finger 210..230 CDD:275370 5/19 (26%)
C2H2 Zn finger 238..260 CDD:275371 0/21 (0%)
C2H2 Zn finger 267..287 CDD:275368 1/19 (5%)
C2H2 Zn finger 295..315 CDD:275368 6/21 (29%)
zf-H2C2_2 309..332 CDD:290200 10/22 (45%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
C2H2 Zn finger 351..374 CDD:275368
C2H2 Zn finger 382..399 CDD:275368
ZNF410NP_001229853.1 zf-C2H2_8 268..351 CDD:292531 32/167 (19%)
C2H2 Zn finger 271..290 CDD:275370 9/18 (50%)
zf-H2C2_2 283..309 CDD:290200 13/53 (25%)
C2H2 Zn finger 298..320 CDD:275368 8/106 (8%)
zf-H2C2_2 312..338 CDD:290200 9/82 (11%)
C2H2 Zn finger 328..350 CDD:275368 6/21 (29%)
zf-H2C2_2 342..367 CDD:290200 10/24 (42%)
C2H2 Zn finger 358..378 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.