DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11247 and Zfp410

DIOPT Version :9

Sequence 1:NP_001097659.1 Gene:CG11247 / 40414 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_659082.1 Gene:Zfp410 / 52708 MGIID:1289280 Length:478 Species:Mus musculus


Alignment Length:377 Identity:80/377 - (21%)
Similarity:131/377 - (34%) Gaps:140/377 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SPPAARESSPGPT---LAIKRRKSSLASLRDACV---DEEEDDGGE-----------------QD 67
            ||...::..|..:   :.:...::.|.|..:..|   ||.||.|.:                 |:
Mouse   106 SPSLLQDLQPSDSTSFILLNLTRAGLGSSAEHFVFVQDETEDSGADFLSAESTDSSIPWFLRVQE 170

  Fly    68 SKDDDYV---QPQLKKSARKGEPVKRKHHVCSQCSKEFGGKTDLQRHMLIHSDERPHKC--KDCG 127
            ...|..:   :.||.|:|:.|...:..|........:..|.        :...|:..||  :.|.
Mouse   171 LAHDSLIAATRAQLAKNAKTGSNGENVHLGSGDGQPKDSGP--------LPQAEKKLKCTVEGCD 227

  Fly   128 KSYRQAVNLKNHITTAHEHRKQFVC--SQCPKSFALKERLRLHMRLHSGEKPYPCDLCDKKFARG 190
            :::....:.|.|:.| |.:.:.|:|  ..|.|||.:.:||::|||.|:||||:.|          
Mouse   228 RTFVWPAHFKYHLKT-HRNERSFICPAEGCGKSFYVLQRLKVHMRTHNGEKPFMC---------- 281

  Fly   191 GQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICENQFANELALRAHI 255
                      |::.        |...|:|..||:                               
Mouse   282 ----------HESG--------CGKQFTTAGNLK------------------------------- 297

  Fly   256 NQEHHKLTQFECEICHKMIEPDEDLATHMQRHTAVKTHVCEV--CNTYFTQKSQYNVHMRMHTGE 318
                                      .|.:.||..|..:||.  |...|.:.|....|:.:|:||
Mouse   298 --------------------------NHRRIHTGEKPFLCEAQGCGRSFAEYSSLRKHLVVHSGE 336

  Fly   319 RPYQCRICHQTFAHSSVLKLHIRKH--------------TGEKPFRCQLCED 356
            :|:||::|.:||:.|....:|:|||              |.|......|.||
Mouse   337 KPHQCQVCGKTFSQSGSRNVHMRKHHLQLGTTGSQEQDQTAEPLMGSSLLED 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 33/162 (20%)
C2H2 Zn finger 95..115 CDD:275368 1/19 (5%)
zf-H2C2_2 107..132 CDD:290200 4/26 (15%)
C2H2 Zn finger 123..144 CDD:275368 5/22 (23%)
C2H2 Zn finger 152..172 CDD:275368 10/21 (48%)
zf-H2C2_2 165..189 CDD:290200 10/23 (43%)
C2H2 Zn finger 180..200 CDD:275368 1/19 (5%)
COG5048 <192..369 CDD:227381 35/181 (19%)
C2H2 Zn finger 210..230 CDD:275370 5/19 (26%)
C2H2 Zn finger 238..260 CDD:275371 0/21 (0%)
C2H2 Zn finger 267..287 CDD:275368 1/19 (5%)
C2H2 Zn finger 295..315 CDD:275368 6/21 (29%)
zf-H2C2_2 309..332 CDD:290200 10/22 (45%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
C2H2 Zn finger 351..374 CDD:275368 3/6 (50%)
C2H2 Zn finger 382..399 CDD:275368
Zfp410NP_659082.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..113 2/6 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..214 4/34 (12%)
SFP1 <189..300 CDD:227516 34/204 (17%)
C2H2 Zn finger 221..243 CDD:275368 5/22 (23%)
C2H2 Zn finger 251..273 CDD:275368 10/21 (48%)
zf-H2C2_2 265..292 CDD:372612 14/54 (26%)
C2H2 Zn finger 281..303 CDD:275368 8/106 (8%)
zf-H2C2_2 295..321 CDD:372612 9/82 (11%)
C2H2 Zn finger 311..333 CDD:275368 6/21 (29%)
zf-H2C2_2 325..350 CDD:372612 10/24 (42%)
C2H2 Zn finger 341..361 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.