DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11247 and ZNF675

DIOPT Version :9

Sequence 1:NP_001097659.1 Gene:CG11247 / 40414 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_612203.2 Gene:ZNF675 / 171392 HGNCID:30768 Length:568 Species:Homo sapiens


Alignment Length:322 Identity:116/322 - (36%)
Similarity:167/322 - (51%) Gaps:12/322 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 QLKKSARKGEPVKRKHHVCSQCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHIT 141
            :.||...:.:|.|     |.:|.|.|...:.|..|.:||:.|:|:||::|||::.|..||..| .
Human   245 EYKKDYAREKPYK-----CEECGKAFNQSSHLTTHKIIHTGEKPYKCEECGKAFNQFSNLTTH-K 303

  Fly   142 TAHEHRKQFVCSQCPKSFALKERLRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVSHHKTSIQ 206
            ..|...:.::|.:|.|:|.....|..|.|:|:|||||.|:.|.|.|.|..:|.:|...|  |..|
Human   304 KIHTGEQPYICEECGKAFTQSSTLTTHKRIHTGEKPYKCEECGKAFNRSSKLTEHKNIH--TGEQ 366

  Fly   207 QFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICENQFANELALRAHINQEHHKLTQFECEICH 271
            .:.|.:|..:|:.::||..|.:.|.:...::|..|...|.:..||..| .:.|.....::||.|.
Human   367 PYKCEECGKAFNRSSNLTEHRKIHTEEKPYKCKECGKAFKHSSALTTH-KRIHTGEKPYKCEECG 430

  Fly   272 KMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVL 336
            |.......|..|.:.||..|.:.||.|...|.|.|:...|.::|:||.||:|..|.:.|.|||.|
Human   431 KAFNRSSKLTEHKKLHTGKKPYKCEECGKAFIQSSKLTEHKKIHSGEIPYKCEECGKAFKHSSSL 495

  Fly   337 KLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHDFFKIKVELQSH 398
            ..|.|.||||||::|:.|..  |||:.:.|..| |.||..:|||.||.|...|.....|..|
Human   496 TTHKRIHTGEKPYKCEECGK--AFSRSSKLTEH-KIIHTGEKPYKCERCDKAFNQSANLTKH 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 54/158 (34%)
C2H2 Zn finger 95..115 CDD:275368 6/19 (32%)
zf-H2C2_2 107..132 CDD:290200 11/24 (46%)
C2H2 Zn finger 123..144 CDD:275368 8/20 (40%)
C2H2 Zn finger 152..172 CDD:275368 7/19 (37%)
zf-H2C2_2 165..189 CDD:290200 13/23 (57%)
C2H2 Zn finger 180..200 CDD:275368 7/19 (37%)
COG5048 <192..369 CDD:227381 61/176 (35%)
C2H2 Zn finger 210..230 CDD:275370 6/19 (32%)
C2H2 Zn finger 238..260 CDD:275371 6/21 (29%)
C2H2 Zn finger 267..287 CDD:275368 6/19 (32%)
C2H2 Zn finger 295..315 CDD:275368 7/19 (37%)
zf-H2C2_2 309..332 CDD:290200 9/22 (41%)
C2H2 Zn finger 323..343 CDD:275368 9/19 (47%)
C2H2 Zn finger 351..374 CDD:275368 8/22 (36%)
C2H2 Zn finger 382..399 CDD:275368 6/17 (35%)
ZNF675NP_612203.2 KRAB 4..62 CDD:214630
KRAB 4..43 CDD:279668
COG5048 169..556 CDD:227381 116/322 (36%)
C2H2 Zn finger 174..194 CDD:275370
C2H2 Zn finger 202..222 CDD:275368
C2H2 Zn finger 230..250 CDD:275368 2/4 (50%)
C2H2 Zn finger 258..278 CDD:275368 6/19 (32%)
zf-H2C2_2 270..295 CDD:290200 11/24 (46%)
C2H2 Zn finger 286..306 CDD:275368 8/20 (40%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
zf-H2C2_2 327..351 CDD:290200 13/23 (57%)
C2H2 Zn finger 342..362 CDD:275368 7/19 (37%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
zf-H2C2_2 382..407 CDD:290200 7/24 (29%)
C2H2 Zn finger 398..418 CDD:275368 6/20 (30%)
zf-H2C2_2 410..435 CDD:290200 8/25 (32%)
C2H2 Zn finger 426..446 CDD:275368 6/19 (32%)
C2H2 Zn finger 454..474 CDD:275368 7/19 (37%)
C2H2 Zn finger 482..502 CDD:275368 9/19 (47%)
zf-H2C2_2 494..519 CDD:290200 13/26 (50%)
C2H2 Zn finger 510..530 CDD:275368 8/22 (36%)
C2H2 Zn finger 538..558 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.