DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and RCCD1

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_001017919.1 Gene:RCCD1 / 91433 HGNCID:30457 Length:376 Species:Homo sapiens


Alignment Length:348 Identity:80/348 - (22%)
Similarity:123/348 - (35%) Gaps:105/348 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 FCSGSQELFVVLTNGSVQRQATGSGRDVGHPHAWQTLGFDPLELHAEGVRIRRVCCSAQGVVFVG 153
            ||...|||            .:|.||.|..|        .||.   .||.|.||..|.....||.
Human    14 FCGFGQEL------------GSGRGRQVHSP--------SPLR---AGVDICRVSASWSYTAFVT 55

  Fly   154 ASGETYVMGS-------CGEVFKAEQQPRHMRLYEEGKELLDLAAGNEHFVMLVAPYNLADDALQ 211
            ..|...:.||       |.:.:.:|.....:|.....:.||.:.|              |:.||:
Human    56 RGGRLELSGSASGAAGRCKDAWASEGLLAVLRAGPGPEALLQVWA--------------AESALR 106

  Fly   212 ---------LSVASAKEEPEDE------------RASVKSISSGHSERSVAANTRHL-LHQGYAL 254
                     :..|..:::|..|            ||.|...:..:...:.....|.| |...:||
Human   107 GEPLWAQNVVPEAEGEDDPAGEAQAGRLPLLPCARAYVSPRAPFYRPLAPELRARQLELGAEHAL 171

  Fly   255 L---HTQLFTFGASNNGLLGSGDHIRRANVMRLQKLDSMGVCSIAAGLEHTVARTLDGRLYHWGL 316
            |   ..|:|::|...:|.||.|..........|:.|..:.:..:|||..|:|..:..|.:|.||.
Human   172 LLDAAGQVFSWGGGRHGQLGHGTLEAELEPRLLEALQGLVMAEVAAGGWHSVCVSETGDIYIWGW 236

  Fly   317 NNHSQL----------GEDVS------------------------SPMEITITENTAALPIEQNS 347
            |...||          ||.|:                        :|. |.:....|.|.:...|
Human   237 NESGQLALPTRNLAEDGETVAREATELNEDGSQVKRTGGAEDGAPAPF-IAVQPFPALLDLPMGS 300

  Fly   348 -ALEATCGDYHTLLLNASGQIHS 369
             |::|:||..||.::..:|::::
Human   301 DAVKASCGSRHTAVVTRTGELYT 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 13/45 (29%)
RCC1_2 292..321 CDD:290274 10/28 (36%)
RCC1 308..361 CDD:278826 21/87 (24%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
RCCD1NP_001017919.1 Interaction with KDM8. /evidence=ECO:0000269|PubMed:24981860 1..169 41/191 (21%)
ATS1 <156..340 CDD:227511 42/169 (25%)
RCC1 2 176..227 14/50 (28%)
RCC1 3 229..317 21/88 (24%)
RCC1 4 318..371 1/6 (17%)
RCC1 319..366 CDD:395335 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.