DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and RSPH1

DIOPT Version :10

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_543136.1 Gene:RSPH1 / 89765 HGNCID:12371 Length:309 Species:Homo sapiens


Alignment Length:293 Identity:71/293 - (24%)
Similarity:110/293 - (37%) Gaps:52/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   750 GVLHGNCYLEYPDGSVYCGELQHGIIEGFGKMVIPTTGLYVGNFKGGRFHGHGVYEMHCKDSPES 814
            |..||......|:|..|.|..:.|...|.|.........|:|.:...:.||.|.:..     |:.
Human    28 GERHGRGRARLPNGDTYEGSYEFGKRHGQGIYKFKNGARYIGEYVRNKKHGQGTFIY-----PDG 87

  Fly   815 EVYEGNFCEGLFHGHGVMRN-NRYIYVGEYQANARSGYGVIEDLVSGDKYMGMFADNKRSGIGSC 878
            ..|||.:...|.|||||... |...|.||:.|:.|.|.|......:|.||:|.:.:.::.|....
Human    88 SRYEGEWANDLRHGHGVYYYINNDTYTGEWFAHQRHGQGTYLYAETGSKYVGTWVNGQQEGTAEL 152

  Fly   879 ITNRGDYFEGSFSGDDLTGSGVAVFENDYYYEGELTLLGPNGRGEYYMPSGDACGGSGAMGTGEF 943
            | :....::|.|...:..|.|..||:           :|....|||.:..         |..||.
Human   153 I-HLNHRYQGKFLNKNPVGPGKYVFD-----------VGCEQHGEYRLTD---------MERGEE 196

  Fly   944 DDTCELIGNKMFGQLSGTWDTVRIQAGELVL-NRRFPKYPSSL---------GRQVVDHNRKWRS 998
            ::..||:      .:...|...:|.  ||.| ....||.|:|.         .....:...:.::
Human   197 EEEEELV------TVVPKWKATQIT--ELALWTPTLPKKPTSTDGPGQDAPGAESAGEPGEEAQA 253

  Fly   999 LFNNFESDLANCTASTSSSGGNQSAGTLRKSSK 1031
            |...||.::       ....|::.|..||:.|:
Human   254 LLEGFEGEM-------DMRPGDEDADVLREESR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 ATS1 <238..>367 CDD:444065
PH-like 616..715 CDD:473070
COG4642 <745..890 CDD:443680 40/140 (29%)
PLN03185 835..>962 CDD:215619 29/126 (23%)
VPS9 1373..1479 CDD:460489
RSPH1NP_543136.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 4/13 (31%)
COG4642 <15..176 CDD:443680 43/153 (28%)
MORN 1 20..43 5/14 (36%)
MORN 2 44..66 5/21 (24%)
MORN 3 67..89 6/26 (23%)
MORN 4 90..112 10/21 (48%)
MORN 5 113..135 7/21 (33%)
MORN 6 159..181 7/32 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..309 12/65 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.