DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and JPH4

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_001139500.1 Gene:JPH4 / 84502 HGNCID:20156 Length:628 Species:Homo sapiens


Alignment Length:413 Identity:105/413 - (25%)
Similarity:151/413 - (36%) Gaps:116/413 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   779 GKMVIPTTGLYVGNFKGGRFHGHGV---------YE---MHCKDS------PESEVYEGNFCEGL 825
            ||......|.|||.::.||.||:||         |.   .|..:|      |....|:|::.:|.
Human     5 GKFDFDDGGCYVGGWEAGRAHGYGVCTGPGAQGEYSGCWAHGFESLGVFTGPGGHSYQGHWQQGK 69

  Fly   826 FHGHGVMRNNRYIYVGEYQANARSGYGVIEDLVSGDKYMGMFADNKRSGIGSCITNRGDYFEGSF 890
            ..|.||.|.:|:.|.||:....:...||.|. |||.:|.|::.|..:.|.|:...:.|..::|.:
Human    70 REGLGVERKSRWTYRGEWLGGLKGRSGVWES-VSGLRYAGLWKDGFQDGYGTETYSDGGTYQGQW 133

  Fly   891 SGDDLTGSGVAVFENDYYYEGELTLLGP------NGRGEYYMP------SGDACGGSGAMGT-GE 942
            ......|.||.  ::..|::..| |..|      :|..:...|      .||. |||.|.|: |.
Human   134 QAGKRHGYGVR--QSVPYHQAAL-LRSPRRTSLDSGHSDPPTPPPPLPLPGDE-GGSPASGSRGG 194

  Fly   943 FDDTCELIGNKMFGQLSGTWDTVRIQAG------ELVLN------RRFPKYPSSLGRQVVDHNRK 995
            |    .|.|.   |...|.....|..|.      .|:|:      ||     ||||         
Human   195 F----VLAGP---GDADGASSRKRTPAAGGFFRRSLLLSGLRAGGRR-----SSLG--------- 238

  Fly   996 WRSLFNNFESDLANCTASTSSSGGNQS-------------------AGTLRKSSKPTLSTAQIWN 1041
              |...:..|::::...||...|...|                   ||..|...:.....:|..|
Human   239 --SKRGSLRSEVSSEVGSTGPPGSEASGPPAAAPPALIEGSATEVYAGEWRADRRSGFGVSQRSN 301

  Fly  1042 CI---AVYMSKQRAREG--TKP------GNYFNNILLS-------LPL-------PQKTSSPLAK 1081
            .:   ..::..:|...|  |:|      |.|..|.|:.       |||       .:|....:..
Human   302 GLRYEGEWLGNRRHGYGRTTRPDGSREEGKYKRNRLVHGGRVRSLLPLALRRGKVKEKVDRAVEG 366

  Fly  1082 ARTTTSALSKLQ-TEAASALDFL 1103
            ||...||..:.| ..||.|.|.|
Human   367 ARRAVSAARQRQEIAAARAADAL 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826
RCC1_2 292..321 CDD:290274
RCC1 308..361 CDD:278826
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
JPH4NP_001139500.1 PLN03185 5..>143 CDD:215619 41/138 (30%)
MORN 1 50..72 4/21 (19%)
MORN 2 74..95 7/20 (35%)
MORN 3 96..117 9/21 (43%)
MORN 4 118..140 3/21 (14%)
MORN 5 141..163 6/24 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..214 17/63 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..276 12/60 (20%)
PLN03185 281..>340 CDD:215619 13/58 (22%)
MORN 7 317..339 7/21 (33%)
MORN 8 340..362 4/21 (19%)
PRK07003 <369..>606 CDD:235906 8/21 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..602
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.