DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and rcbtb2

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:XP_005173422.1 Gene:rcbtb2 / 794652 ZFINID:ZDB-GENE-071016-3 Length:527 Species:Danio rerio


Alignment Length:328 Identity:79/328 - (24%)
Similarity:120/328 - (36%) Gaps:73/328 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 DLQLLRTDVVDMDFCSGSQELFVVLTNGSVQRQATG-SGRDVGHPHAWQTLGFDPLELHAEGVRI 139
            :|:|:|...|   |.|.:.|...|..|..|....|. ||          .||....:...|..||
Zfish    17 ELRLIRQACV---FGSAANEAIYVTVNDEVFALGTNCSG----------CLGLGDTQSTIEPRRI 68

  Fly   140 RRVC---------CSAQGVVFVGASGETYVMGSCGEVFKAEQQPRH------MRLYEEGKELLDL 189
            ..:|         .:...||...|.||.|..|..|..........|      :.....||.:.::
Zfish    69 DILCGKKIISLSYGTGPHVVIATADGEVYAWGHNGYSQLGNGTTNHGLTPALVSTNLIGKRVTEV 133

  Fly   190 AAGNEHFVMLVAP-------YNLADDALQLSVASAKEEPEDERAS-------VKSISSGHSERSV 240
            :.|:.|.:.|...       ||   ::.|:...|...:|...|.|       |.:|:.|.     
Zfish   134 SCGSHHTIALTTDGEVYAWGYN---NSGQVGSGSTANQPTPRRVSSCLQNKVVVNIACGQ----- 190

  Fly   241 AANTRHLLHQGYALLHTQLFTFGASNNGLLGSGDHIRRANVMRLQKLDSMGVCSIAAGLEHTVAR 305
                   |.....|.:.:.:.:|.:.||.||.|::..:....|:..|..:.:..:|.|..||:|.
Zfish   191 -------LCSMAVLDNGETYGWGYNCNGQLGLGNNGNQQTPCRIAALQGINIIQVACGYAHTLAL 248

  Fly   306 TLDGRLYHWGLNNHSQLGEDVSSPMEITITENTAALPIEQNSALE-----ATCGDYHTLLLNA-S 364
            |.:|.:|.||.|::.|||         |..::..|:|...|...|     |.|...||..... |
Zfish   249 TDEGFVYSWGANSYGQLG---------TGNKSNQAVPTLINMDKERMVEVAACHTSHTSAAKTQS 304

  Fly   365 GQI 367
            ||:
Zfish   305 GQV 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 12/45 (27%)
RCC1_2 292..321 CDD:290274 11/28 (39%)
RCC1 308..361 CDD:278826 17/57 (30%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
rcbtb2XP_005173422.1 RCC1 40..89 CDD:278826 12/58 (21%)
RCC1 93..143 CDD:278826 10/49 (20%)
RCC1 146..196 CDD:278826 11/64 (17%)
RCC1 199..248 CDD:278826 12/48 (25%)
RCC1 251..299 CDD:278826 17/56 (30%)
BTB 364..460 CDD:279045
BTB 371..463 CDD:197585
SPOP_C_like 463..521 CDD:269810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.