DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Als2 and Morn3

DIOPT Version :9

Sequence 1:	NP_649347.1	Gene:	Als2 / 40410	FlyBaseID:	FBgn0037116	Length:	1486	Species:	Drosophila melanogaster
Sequence 2:	NP_083388.1	Gene:	Morn3 / 74890	MGIID:	1922140	Length:	241	Species:	Mus musculus

Alignment Length:	144	Identity:	45/144 - (31%)
Similarity:	67/144 - (46%)	Gaps:	12/144 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   789 YVGNFKGGRFHGHGVYEMHCKDSPESEVYEGNFCEGLFHGHGVMRNN-------RYIYVGEYQAN 846
            |||.:||...||.|....    .....||||::..|...|:|.:.:.       |.:|.|.::.:
Mouse    38 YVGEWKGNLKHGKGTQVW----KKSGAVYEGDWKFGKRDGYGSLSHPDPETGKLRRVYSGWWKGD 98

  Fly   847 ARSGYGVIEDLVSGDKYMGMFADNKRSGIGSCITNRGDYFEGSFSGDDLTGSGVAVFENDYYYEG 911
            .:|||| |:.....:.|.|.:.:|:|||.|....|.||.:||.:..|...|.|:...:|...|||
Mouse    99 KKSGYG-IQFFGPKEYYEGEWCNNQRSGWGRMYYNNGDIYEGQWQNDKPEGEGMLRLKNGNRYEG 162

  Fly   912 ELTLLGPNGRGEYY 925
            .......||.|.::
Mouse   163 IWERGMKNGHGRFF 176

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Als2	NP_649347.1	RCC1	258..304	CDD:278826
		RCC1_2	292..321	CDD:290274
		RCC1	308..361	CDD:278826
		PH-like	616..715	CDD:302622
		VPS9	1373..1479	CDD:280383
Morn3	NP_083388.1	PLN03185	34..>190	CDD:215619	45/144 (31%)
		MORN 1	38..60		8/25 (32%)
		MORN 2	62..84		6/21 (29%)
		MORN 3	91..113		7/22 (32%)
		MORN 4	114..136		9/21 (43%)
		MORN 5	137..159		6/21 (29%)
		MORN 6	160..182		6/17 (35%)
		MORN 7	184..205
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4642
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.900