DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and Rcc1

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:XP_006239135.1 Gene:Rcc1 / 682908 RGDID:1592835 Length:434 Species:Rattus norvegicus


Alignment Length:327 Identity:75/327 - (22%)
Similarity:119/327 - (36%) Gaps:84/327 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SGSQELFVVLTNGSVQRQATGSGRDVGHPHAWQTLGFDPLE-------------LHAEGVRIRRV 142
            |.:.|..:|||        .|.| |||.    ..||...||             :.||...:..|
  Rat    42 SHNTEPGLVLT--------LGQG-DVGQ----LGLGESVLERKKPALVPLLQDVVQAEAGGMHTV 93

  Fly   143 CCSAQGVVFVGASGETYVMGSCGEVFKAEQQPRHMRLYEEGKELLDLAAGNEHFVMLVAPYNLAD 207
            |.|..|.|:.....:...:|....|..:|..|..:.|.|   :::.::||:.|...      |.:
  Rat    94 CLSQSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQE---KVVQVSAGDSHTAA------LTE 149

  Fly   208 DALQLSVASAKE--------EPEDERASVKSISSGHSERSVAANTRHLLHQGYALLHT--QLFTF 262
            |.......|.::        ||..:......:........||:...||:     :|.|  .|:|.
  Rat   150 DGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDTQVVKVASGNDHLV-----MLTTDGDLYTL 209

  Fly   263 GASNNGLL----------GSGDHIRRANVMRLQKLDSMGV----------CSIAAGLEHTVARTL 307
            |....|.|          |....:.|..|.|...|.|.|.          |    |...|.|.:.
  Rat   210 GCGEQGQLGRVPELFANRGGRQGLERLLVPRCVLLKSRGTRGRVRFQDAFC----GAYFTFAISR 270

  Fly   308 DGRLYHWGLNNHSQLGEDVSS----PMEITITENTAALPIEQNSALEATCGDYHTLLLNASGQIH 368
            :|.:|.:||:|:.|||...:.    |..:|..:|:.      .|.:..:.|.:||:.:::.|:.:
  Rat   271 EGHVYGFGLSNYHQLGTPGTGSCFIPQNLTSFKNST------KSWVGFSGGQHHTVCMDSEGKAY 329

  Fly   369 SL 370
            ||
  Rat   330 SL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 15/65 (23%)
RCC1_2 292..321 CDD:290274 9/38 (24%)
RCC1 308..361 CDD:278826 15/56 (27%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
Rcc1XP_006239135.1 ATS1 19..432 CDD:227511 75/327 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.