DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and Jph3

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_065630.1 Gene:Jph3 / 57340 MGIID:1891497 Length:744 Species:Mus musculus


Alignment Length:511 Identity:114/511 - (22%)
Similarity:172/511 - (33%) Gaps:161/511 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   760 YPDGSVYCGELQHGIIEGFGKMVIPT-TGLYVGNFKGGRFHGHGVYEMHCKDSPESEVYEGNFCE 823
            :.||..|||..:.|...|.|....|. .|.|.|::..| |...|||..     |....|:|.:.:
Mouse     9 FDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHG-FEVLGVYTW-----PSGNTYQGTWAQ 67

  Fly   824 GLFHGHGVMRNNRYIYVGEYQANARSGYGVIEDLVSGDKYMGMFADNKRSGIGSCITNRGDYFEG 888
            |..||.|:....:::|.||:....:..|||.|...:|.||.|.:::..:.|.|:...:.|..::|
Mouse    68 GKRHGIGLESKGKWVYKGEWTHGFKGRYGVRECTGNGAKYEGTWSNGLQDGYGTETYSDGGTYQG 132

  Fly   889 SFSGDDLTGSGVAVFENDYYYEGELTLLGP-------------NGRGEYYMPSGDACGGSGAMGT 940
            .:.|....|.||   .....|.....:..|             || ...:..:..|..||.|:..
Mouse   133 QWVGGMRQGYGV---RQSVPYGMAAVIRSPLRTSINSLRSEHTNG-AALHPDASPAVAGSPAVSR 193

  Fly   941 GEF----DDTCELIGNKMFG-----QLSGTWDTVRIQAGELVLNRRFPKYPSSLGRQVVDHNRKW 996
            |.|    ....|::.:|..|     .|||             |..|..:..|||..|        
Mouse   194 GGFVLVAHSDSEILKSKKKGLFRRSLLSG-------------LKLRKSESKSSLASQ-------- 237

  Fly   997 RSLFNNFESDLANCTASTSSS------------------------------------------GG 1019
            ||..::|.|:....|.|:::|                                          |.
Mouse   238 RSKQSSFRSEAGMSTVSSTASDIHSTISLGEAEAELAVIEDDIDATTTETYVGEWKNDKRSGFGV 302

  Fly  1020 NQSAGTLRKSSKPTLSTAQIWNCIAVYMSKQRAREGTK-PGNYFNNILLS------LPL------ 1071
            :|.:..|:...:...:....:.|:..       .:||| .|.|..|:|:|      :||      
Mouse   303 SQRSDGLKYEGEWVSNRRHGYGCMTF-------PDGTKEEGKYKQNVLVSGKRKNLIPLRASKIR 360

  Fly  1072 ------------------------PQKTSSPLAKARTTTSALSKLQTEA----ASALDFL----- 1103
                                    ..:||...|||....:|..|.|.||    .:|.:|.     
Mouse   361 EKVDRAVEAAERAATIAKQKAEIAASRTSHSRAKAEAALTAAQKAQEEARIARITAKEFSPSFQH 425

  Fly  1104 ---GFPPRRIQSQ------EALNSKPGGLQRADSLISMGHNTSRDL--DNSSLASF 1148
               |...:|.:.|      |.|::.....|.:..|...| .|..||  |:|.|.||
Mouse   426 RENGLEYQRPKHQMSCDDIEVLSTGTPLQQESPELYRKG-TTPSDLTPDDSPLQSF 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826
RCC1_2 292..321 CDD:290274
RCC1 308..361 CDD:278826
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
Jph3NP_065630.1 PLN03185 5..>144 CDD:215619 41/140 (29%)
MORN 1 15..37 7/21 (33%)
MORN 2 39..60 8/26 (31%)
MORN 3 61..82 6/20 (30%)
MORN 4 83..105 7/21 (33%)
MORN 5 107..129 5/21 (24%)
MORN 6 130..152 6/24 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..252 8/29 (28%)
PLN03185 287..>342 CDD:215619 9/61 (15%)
MORN 7 288..310 2/21 (10%)
MORN 311..333 CDD:308220 2/28 (7%)
MORN 8 311..333 2/28 (7%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 451..603 11/31 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 624..677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.