DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and Jph1

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_065629.1 Gene:Jph1 / 57339 MGIID:1891495 Length:660 Species:Mus musculus


Alignment Length:603 Identity:126/603 - (20%)
Similarity:202/603 - (33%) Gaps:148/603 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   759 EYPDGSVYCGELQHGIIEGFGKMVIPT-TGLYVGNFKGGRFHGHGVYEMHCKDSPESEVYEGNFC 822
            ::.||..|||..:.|...|.|....|. .|.|.|::..| |...|||..     |....|:|.:.
Mouse     7 DFDDGGTYCGGWEEGKAHGHGICTGPKGQGEYSGSWSHG-FEVVGVYTW-----PSGNTYQGYWA 65

  Fly   823 EGLFHGHGVMRNNRYIYVGEYQANARSGYGVIEDLVSGDKYMGMFADNKRSGIGSCITNRGDYFE 887
            :|..||.||....:::|.||:....:..|||.:.|.:..:|.|.:::..:.|.|......|..::
Mouse    66 QGKRHGLGVETKGKWMYRGEWSHGFKGRYGVRQSLCTPARYEGTWSNGLQDGYGVETYGDGGTYQ 130

  Fly   888 GSFSGDDLTGSGV--------AVFENDYYYEGELTLLGPNGRGEYYMPSGDACGGSGAMGTGEF- 943
            |.::|....|.||        |............:|......|.....:..|...|.|...|.| 
Mouse   131 GQWAGGMRHGYGVRQSVPYGMATVIRSPLRTSLASLRSEQSNGSVLHEAAAAAADSPAGTRGGFV 195

  Fly   944 ----DDTCELIGNK---MF--GQLSGTWDTVRIQAGELVLNRRFP-KYPSSLGR----------- 987
                .|| || |.|   :|  |.|.|:....:.::...:.::|.. :..:::.|           
Mouse   196 LNFHADT-EL-GKKKGGLFRRGSLLGSMKLRKSESKSSISSKRSSVRSDAAMSRISSSDANSTIS 258

  Fly   988 ---------QVVDH--NRKWRSLFNNFESDLANCTASTSSSGGNQSAGTLRKSSKPTLSTAQIWN 1041
                     .|.||  .....:....:::|..|....:..|.|.:..|....:.:      ..:.
Mouse   259 FGDVDCDFCPVEDHVDATTTETYMGEWKNDKRNGFGISERSNGMKYEGEWANNKR------HGYG 317

  Fly  1042 CIAVYMSKQRAREGTK-PGNYFNNILLS------LPLPQ-KTSSPLAKA-----RTTTSALSKLQ 1093
            |...       .:|:| .|.|.||||:.      :|:.. ||...:.:|     |....|.:|::
Mouse   318 CTVF-------PDGSKEEGKYKNNILVRGIRKQLIPIRNTKTREKVDRAIEGAQRAAAMARTKVE 375

  Fly  1094 ---------TEAASALDFLGFPPRR---IQSQEALNSKPGGLQRADSLISMGHNTSRDLDNSSLA 1146
                     ...|.|.|......|:   |....|....|...|.....|........|:..:.  
Mouse   376 IANSRTAHARAKADAADQAALAARQECDIARAVARELSPDFYQPGPDYIKQRCQEGGDIKENP-- 438

  Fly  1147 SFQLDQSLMNSTVNGDESSTF----------NESFSKLSHNNNNSI---SKHMNNIDCSITSTTS 1198
                ::.::....:..||..|          .||..|.||:...|.   ||..|           
Mouse   439 ----EEKVLEKPPSPKESPHFYRKGTTPPRSPESSPKQSHSPQPSSPEPSKKQN----------- 488

  Fly  1199 TTSAVLDQVPSFGMAL-----VLTEQDVTSI--RLYLEQA-----------FKDRHHPLYVLNER 1245
                     ||.|..|     .|.|:.||:.  :..:.:|           :..|||.....|..
Mouse   489 ---------PSPGARLSQDKQSLAEEQVTAFVNKPSMSKAPAKELGASVSKYSGRHHVPNPSNGE 544

  Fly  1246 IANCFHYSYGYWKVKPTP 1263
            :.:.:|   ||:....||
Mouse   545 LHSQYH---GYYVKLNTP 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826
RCC1_2 292..321 CDD:290274
RCC1 308..361 CDD:278826
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
Jph1NP_065629.1 PLN03185 4..>143 CDD:215619 40/141 (28%)
MORN 1 14..36 7/21 (33%)
MORN 2 38..59 8/26 (31%)
MORN 3 60..82 7/21 (33%)
PLN03185 106..>325 CDD:215619 39/233 (17%)
MORN 4 106..128 5/21 (24%)
MORN 5 129..151 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..247 1/18 (6%)
MORN 6 281..303 4/21 (19%)
MORN 7 304..326 3/34 (9%)
PTZ00449 <424..>621 CDD:185628 32/165 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 437..631 30/152 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.