DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and rcc1l

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_001076272.1 Gene:rcc1l / 555972 ZFINID:ZDB-GENE-060526-370 Length:451 Species:Danio rerio


Alignment Length:267 Identity:53/267 - (19%)
Similarity:93/267 - (34%) Gaps:104/267 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PLELHAEGVRIRRVCC---------SAQGVVFVGASGETYVMGSCG------EVFKAEQQPRHMR 178
            || |:.:..|:.:|.|         .::||..:|::    ..|.||      ||:...    |:.
Zfish   154 PL-LNPQETRVPQVSCGRAHSLVLTDSEGVFSMGSN----TFGQCGRKIVEDEVYSGS----HVV 209

  Fly   179 LYEEG--KELLDLAAGNEHFVMLVAPYNLADDALQLSVASAKEEPEDERASVKSISSGHSERSVA 241
            ...||  ..::.:|.|.:|.:.|.                       :|.||             
Zfish   210 HKIEGFDSRVIQVACGQDHSLFLT-----------------------DRGSV------------- 238

  Fly   242 ANTRHLLHQGYALLHTQLFTFGASNNGLLGSGDHIRRANV----------MRLQKLDSMGVCSIA 296
                              |..|...:|..|.|.| .:|:.          :.:|::.:.|.||:|
Zfish   239 ------------------FACGWGADGQTGLGHH-NKASCPVPVGGDLAGVTVQQVATYGDCSLA 284

  Fly   297 AGLEHTVARTLDGRLYHWGLNNHSQLGEDVSSPMEITITENTAALPIEQNSAL-EATCGDYHTLL 360
            .        :.||:::.||.:.:.||    :|..|.|...:...||::....: :|.||.....:
Zfish   285 V--------STDGQVFGWGNSEYLQL----ASVTESTQISSPRLLPLKGVGRIRQAACGGTQVAV 337

  Fly   361 LNASGQI 367
            ||..|.:
Zfish   338 LNEDGDV 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 12/55 (22%)
RCC1_2 292..321 CDD:290274 7/28 (25%)
RCC1 308..361 CDD:278826 14/53 (26%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
rcc1lNP_001076272.1 RCC1 52..108 CDD:278826
RCC1_2 165..192 CDD:290274 5/30 (17%)
RCC1 182..232 CDD:278826 13/57 (23%)
RCC1_2 219..248 CDD:290274 9/82 (11%)
RCC1 236..285 CDD:278826 13/80 (16%)
RCC1 288..338 CDD:278826 14/53 (26%)
RCC1_2 383..412 CDD:290274
RCC1 400..446 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.