DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and jph2

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_001082833.1 Gene:jph2 / 553333 ZFINID:ZDB-GENE-030131-9848 Length:781 Species:Danio rerio


Alignment Length:430 Identity:95/430 - (22%)
Similarity:141/430 - (32%) Gaps:126/430 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   759 EYPDGSVYCGELQHGIIEGFGKMVIPT-TGLYVGNFKGGRFHGHGVYEMHCKDSPESEVYEGNFC 822
            |:.||..|||..:.|...|.|....|. .|.:.|::..| |...|||..     |....|||.:.
Zfish     7 EFDDGGAYCGGWEGGKAHGHGICTGPKGQGEFSGSWNYG-FEVVGVYTW-----PSGNTYEGYWS 65

  Fly   823 EGLFHGHGVMRNNRYIYVGEYQANARSGYGVIEDLVSGDKYMGMFADNKRSGIGSCITNRGDYFE 887
            :|..||.||.....:||.||:....:..||......||.||.|.:.:..:.|.|:.....|..|:
Zfish    66 QGKRHGLGVETKGHWIYKGEWTHGFKGRYGTRISQGSGAKYEGTWNNGLQDGYGTETYADGGTFQ 130

  Fly   888 GSFSGDDLTGSGV---------AVFEN----------DYYYEGEL------TLLGPNGRGE---- 923
            |.|:|....|.||         ||..:          ..:..|.|      .:...|..|:    
Zfish   131 GQFTGGMRHGYGVRQSVPYGMAAVVHSPLRNSLSSLRSEHSNGTLLQQDVPVITTTNASGQETPV 195

  Fly   924 -YYMPSGDACGG----------------SGAMGTGEF-------DDTCELIGNK---MFGQLSGT 961
             ..||.|.:.||                ||....|.|       |....|...|   .|.:....
Zfish   196 NLPMPLGPSRGGFALTLQVDPDAVKPKKSGLFRRGSFLGKLKKSDSRTSLSSQKSKISFLRTESA 260

  Fly   962 WDTVRIQAGELVLNRRFPKYPSSLGRQVVD---HNRKWRSLFNNFESDLANCTAST--------- 1014
            ..:....|...:          |||....:   ||      |...|:|:...|...         
Zfish   261 LSSAASDANSTI----------SLGESEGEGEGHN------FPPVEADIDATTTEVYMGEWKNDK 309

  Fly  1015 -SSSGGNQSAGTLRKSSKPTLSTAQIWNCIAVYMSKQR--------AREGTKPGNYFNNILL--- 1067
             |..|.::.:..|:...:              :::.||        ...|.:.|.|.||:|:   
Zfish   310 RSGYGISERSSGLKYEGE--------------WLNNQRHGYGCTTFPEGGKEEGKYVNNMLVKSV 360

  Fly  1068 --------SLPLPQKTSSPLAKARTTTSALSKLQTEAASA 1099
                    ...:.||....|..|: ..:|::|.:.|.|::
Zfish   361 KKKMIQLKGTKIKQKVERSLEGAQ-RAAAIAKQKAEIANS 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826
RCC1_2 292..321 CDD:290274
RCC1 308..361 CDD:278826
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
jph2NP_001082833.1 MORN 106..128 CDD:280628 5/21 (24%)
MORN 324..346 CDD:280628 2/35 (6%)
TonB_N 605..757 CDD:292650
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.