DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and RCBTB1

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_001339429.1 Gene:RCBTB1 / 55213 HGNCID:18243 Length:531 Species:Homo sapiens


Alignment Length:634 Identity:124/634 - (19%)
Similarity:203/634 - (32%) Gaps:248/634 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DVGHPHAWQ--TLGFDPLELHAEGVRIRRVC---CSAQGVVFVGASGETYVM------------- 161
            |||   .|.  || ..|.|:    ..||:.|   .||...::|..:.|.:|.             
Human     3 DVG---KWPIFTL-LSPQEI----ASIRKACVFGTSASEALYVTDNDEVFVFGLNYSNCLGTGDN 59

  Fly   162 ----------GSCGEVFKA---EQQPRHMRLYEEG------------------------------ 183
                      |.||:..|:   ...|..:...|:|                              
Human    60 QSTLVPKKLEGLCGKKIKSLSYGSGPHVLLSTEDGVVYAWGHNGYSQLGNGTTNQGIAPVQVCTN 124

  Fly   184 ---KELLDLAAGNEHFVMLVAP-------YNLADDALQLSVASAKEEPEDERAS-------VKSI 231
               |:::::|.|:.|.:.|.|.       ||   :..|:...|...:|...:.:       |..|
Human   125 LLIKQVVEVACGSHHSMALAADGEVFAWGYN---NCGQVGSGSTANQPTPRKVTNCLHIKRVVGI 186

  Fly   232 SSGHSERSVAANTRHLLHQGYALLHTQLFTFGASNNGLLGSGDHIRRANVMRLQKLDSMGVCSIA 296
            :.|.:. |:|     :|..|      :::.:|.:.||.||.|::..:...:|:..|.|:.|..|.
Human   187 ACGQTS-SMA-----VLDNG------EVYGWGYNGNGQLGLGNNGNQLTPVRVAALHSVCVNQIV 239

  Fly   297 AGLEHTVARTLDGRLYHWGLNNHSQLG----EDVSSPMEITITENTAALPIEQNSALE-ATCGDY 356
            .|..||:|.|.:|.||.||.|.:.|||    .::.||         |.:.:|:...:| |.|...
Human   240 CGYAHTLALTDEGLLYAWGANTYGQLGTGNKNNLLSP---------AHIMVEKERVVEIAACHSA 295

  Fly   357 HTLLLNASGQIHSLQPAPPMRHLQQSSTYAQTLLQLQLGAAWPRQLRLLMCSGGYTLQNQRQFQR 421
            ||......|           .|:..                |.:      |.|            
Human   296 HTSAAKTQG-----------GHVYM----------------WGQ------CRG------------ 315

  Fly   422 QYHYYLSHLQSQLQLLLKHRQAVQTLEIWQRQSALEPLSALGPLLINWERILCL----LVATLHS 482
                     ||.:...|.|.....           :..:......::| |:|.:    .:....|
Human   316 ---------QSVILPHLTHFSCTD-----------DVFACFATPAVSW-RLLSVEHEDFLTVAES 359

  Fly   483 LEGFYRADFVQPADLLFICHYKEYIDLFDGYTKAYCDVFSVNGFGEAVVAITGLSSPLAELNEE- 546
            |:..:  |..:.|||.|....| ||.:.....|..|:.|.              |...:..||: 
Human   360 LKKEF--DSPETADLKFRIDGK-YIHVHKAVLKIRCEHFR--------------SMFQSYWNEDM 407

  Fly   547 SYVTRLFQQPFSIYQLFVQFMEL------------LVRTQSEYGEHRV----------------A 583
            ..|..:.|..:.:|:.|:|::..            |:...:.|.|:|:                |
Human   408 KEVIEIDQFSYPVYRAFLQYLYTDTVDLPPEDAIGLLDLATSYCENRLKKLCQHIIKRGITVENA 472

  Fly   584 WS--------------EFARHSCISQELAV-NTKDFWSSNDRNPRIVQF 617
            :|              ||....||:....| .|..||..:  .|.:.:|
Human   473 FSLFSAAVRYDAEDLEEFCFKFCINHLTEVTQTAAFWQMD--GPLLKEF 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 14/45 (31%)
RCC1_2 292..321 CDD:290274 13/28 (46%)
RCC1 308..361 CDD:278826 18/57 (32%)
PH-like 616..715 CDD:302622 1/2 (50%)
VPS9 1373..1479 CDD:280383
RCBTB1NP_001339429.1 RCC1 1 40..91 7/50 (14%)
ATS1 43..>316 CDD:227511 65/350 (19%)
RCC1 2 93..145 6/51 (12%)
RCC1 3 147..198 10/59 (17%)
RCC1 4 199..250 16/56 (29%)
RCC1 5 252..302 18/58 (31%)
RCC1 6 304..356 12/117 (10%)
BTB_POZ_RCBTB1_CLLD7 350..466 CDD:349662 25/132 (19%)
BACK_RCBTB1 466..531 CDD:350603 12/56 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.