DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and rcbtb2

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_001004950.1 Gene:rcbtb2 / 448359 XenbaseID:XB-GENE-952598 Length:526 Species:Xenopus tropicalis


Alignment Length:491 Identity:107/491 - (21%)
Similarity:185/491 - (37%) Gaps:108/491 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DVGHPHAWQTLGFDPLELHAEGVRIRRVCCSAQG--VVFVGASGETYVMGS----CGEVFKAEQ- 172
            |||   .|......|.|   :...|::.|....|  |:::..:.|.:|||:    |.....|:. 
 Frog     3 DVG---KWPIFALCPQE---DLKFIQQACVFGAGNEVLYLTKNDEVFVMGTNSSGCLGTGDAQSI 61

  Fly   173 -QPRHMRLYEEGKELLDLAAGNEHFVMLVAP----YNLADDAL-QLSVASAKEEPEDERASVKSI 231
             :||.:.:. .||.::.|:.|:...|::|..    |:...:|. ||...|..:.....:.|...|
 Frog    62 LEPRRIDML-SGKRIVSLSYGSGPHVVIVTSDGEVYSWGHNAYSQLGNGSTNQALSPCQVSTNLI 125

  Fly   232 SSGHSERSVAANTRH---LLHQGYALLHTQLFTFGASNNGLLGSGDHIRRANVMRLQK-LDSMGV 292
            :.  ...|||..:.|   |...|      :::.:|.:|:|.:|||....:....::.. |.:..|
 Frog   126 NK--KAISVACGSHHSMVLTCDG------EVYAWGYNNSGQVGSGSTANQPIPRKVTSCLQNKTV 182

  Fly   293 CSIAAGLEHTVARTLDGRLYHWGLNNHSQLGEDVS----SPMEITITENTAALPIEQNSALEATC 353
            ..||.|...::|...:|.:|.||.|.:.|||...|    :|..|...:   .:.:||     ..|
 Frog   183 IGIACGQMSSMAVVDNGEVYAWGYNGNGQLGLGSSGNQPTPCRIAALQ---GIRVEQ-----VVC 239

  Fly   354 GDYHTLLLNASGQIHSLQPAPPMRHLQQSSTYAQTLLQLQLGAAWP--------RQLRLLMCSGG 410
            |..|||.|...|.:::          ..:::|.|.....:...::|        |.:.:..|...
 Frog   240 GYAHTLALTDEGVMYA----------WGANSYGQLGTGNKSNQSYPVQVIVDKERIVEIAACHSS 294

  Fly   411 YTLQNQRQFQRQYHYYLSHLQSQLQLLLKHRQAV-------QTLEIWQRQSALEPLSALGPLLIN 468
            :|...:.|..:.|.:.....||.:...|.|....       .|..|..|..::||...|      
 Frog   295 HTSAAKSQSGQVYMWGQCRGQSVITPHLTHFSCTDDVFACFSTPAIMWRLLSVEPDDHL------ 353

  Fly   469 WERILCLLVATLHSLEGFYRADFVQP--ADLLFICHYKEYIDLFDGYTKAYCDVFSVNGFGEAVV 531
                     ....||    :.:|..|  |||.|:...| ||.:.....:..|:.|          
 Frog   354 ---------TVAESL----KREFDNPNTADLKFLVDEK-YIYVHKVLLQIRCEHF---------- 394

  Fly   532 AITGLSSPLAELNEESYVTRLFQQPFSIYQLFVQFM 567
                  ..|...|||. :..:.|..:.:|:.|::::
 Frog   395 ------RSLLHENEEE-IIEMNQFSYPVYRAFLEYL 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 11/46 (24%)
RCC1_2 292..321 CDD:290274 10/28 (36%)
RCC1 308..361 CDD:278826 18/56 (32%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
rcbtb2NP_001004950.1 ATS1 <17..269 CDD:227511 65/278 (23%)
RCC1 250..298 CDD:366085 7/57 (12%)
BTB_POZ 349..465 CDD:365784 22/112 (20%)
BACK_RCBTB2 462..526 CDD:350604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.