DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and CG6678

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster


Alignment Length:336 Identity:77/336 - (22%)
Similarity:120/336 - (35%) Gaps:90/336 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 DMDFCSGSQELFVVLTNGSVQRQATGSGRDVGHPHAWQTLGF---------------DPLELHAE 135
            |:|..:|..||...:   |.|.|.|.|   :|..:|  .|.|               :.:.|.|.
  Fly    20 DVDCAAGFSELNAPV---STQNQCTIS---IGWRYA--ALAFGRKLCLRGLLDDGPNECVTLEAT 76

  Fly   136 GVRIRRVCCSAQGVVFVGASGETYVM---------------------GSCGEVFKAEQQPRHMRL 179
            | .||.:..:....:.:..||:.|.:                     |:...:|.|.:.|     
  Fly    77 G-NIRALAAADSHCLVLLQSGQLYRVQPKLQAELVAVRLEAAPRSNSGTKRSIFGAAKAP----- 135

  Fly   180 YEEGKELLDLAAGNEHFVMLVAPYNLADDALQLSVASAKEEPEDERASVKSISSGHSERSVAANT 244
               ...:::..|...|..:.::..|..     .|:.|...:..:.:..||.:..|| |.:|..|.
  Fly   136 ---SSPIIEHIACGSHINVAISSENCV-----YSIPSCLHQFSERQFRVKQLQCGH-EHAVLLNA 191

  Fly   245 RHLLHQGYALLHTQLFTFGASNNGLLGSGDHIRRANVMRLQKLDSMGVCSIAAGLEHTVARTLDG 309
                       :..:||:|....|.||..:.........|:.|..:.:..||||..|:.|.:..|
  Fly   192 -----------NGDVFTWGNGLRGQLGLAELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFG 245

  Fly   310 RLYHWGLNNHSQLGEDVSSPMEITITENTAALPIEQNSAL-EATC-----------------GDY 356
            .||.||||...|||..|..|..: :.|.| ..|:.|...| |..|                 |..
  Fly   246 DLYTWGLNCSGQLGLRVMKPGGV-LKEPT-VFPLPQLQDLPECACSQSGESNDDCAPLRVFAGSR 308

  Fly   357 HTLLLNASGQI 367
            ||||:...|::
  Fly   309 HTLLIRRCGRL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 13/45 (29%)
RCC1_2 292..321 CDD:290274 13/28 (46%)
RCC1 308..361 CDD:278826 23/70 (33%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 60/269 (22%)
RCC1_2 176..205 CDD:290274 10/40 (25%)
RCC1 192..241 CDD:278826 13/48 (27%)
RCC1_2 228..257 CDD:290274 13/28 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.