DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and rcc2

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_998341.1 Gene:rcc2 / 406455 ZFINID:ZDB-GENE-040426-2213 Length:495 Species:Danio rerio


Alignment Length:213 Identity:51/213 - (23%)
Similarity:84/213 - (39%) Gaps:64/213 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 PYNLADDAL------------QLSVASA--------KEEPEDERA-------------------- 226
            |..:|||..            ||.:..|        ||.|:.:.|                    
Zfish    57 PVTVADDVKEKIKLEVPKVKGQLLIFGATNWDLIGRKEVPKQQAAFRNLGQNLWGPHRYGCLSDV 121

  Fly   227 SVKSISSGHSERSVAANTRHLLHQGYALLHTQLFTFGASNNGLLGSGDHIRRANVMRLQKLDSMG 291
            .|..:.||    ..||::..:..:|      :|:::|.::.|.||.||..|......::.|....
Zfish   122 QVSCVVSG----PCAAHSLIITTEG------KLWSWGRNDKGQLGHGDTKRLEAPKLIEGLGEEV 176

  Fly   292 VCSIAAGLEHTVARTLDGRLYHWGLNNHSQLGED-----VSSPMEITITENTAALPIEQNSALEA 351
            :.:.|.|..||:|.|.:|.:|.:|.|...|||:.     |.||  .||..|  ..||     ::.
Zfish   177 IVAAACGRNHTLALTENGTVYTFGENKLGQLGQGNQTDAVLSP--ATIQYN--GQPI-----VKV 232

  Fly   352 TCGDYHTLLLNASGQIHS 369
            .||...:::::..|.::|
Zfish   233 ACGAEFSMIVDCKGNLYS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 13/45 (29%)
RCC1_2 292..321 CDD:290274 10/28 (36%)
RCC1 308..361 CDD:278826 17/57 (30%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
rcc2NP_998341.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
RCC1 1 76..138 12/65 (18%)
RCC1_2 121..154 CDD:290274 8/42 (19%)
RCC1 2 141..192 15/56 (27%)
RCC1 141..190 CDD:278826 14/54 (26%)
RCC1 193..242 CDD:278826 17/57 (30%)
RCC1 3 194..244 17/58 (29%)
RCC1 245..318 CDD:278826 2/6 (33%)
RCC1 4 246..320 2/5 (40%)
Required for interaction with RAC1. /evidence=ECO:0000250|UniProtKB:Q9P258 291..298
RCC1 5 321..374
RCC1 323..372 CDD:278826
RCC1 6 376..420
RCC1 7 421..474
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.