DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and Rpgr

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:XP_038955861.1 Gene:Rpgr / 367733 RGDID:1560136 Length:1380 Species:Rattus norvegicus


Alignment Length:241 Identity:58/241 - (24%)
Similarity:98/241 - (40%) Gaps:40/241 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 LAAGNEHFVMLVAP---YNLADD---ALQLSVASAKEEPEDERA----SVKSISSGHSERSVAAN 243
            |:.|:||..::...   |....:   .|.|...||..:|...:|    .||..:.|.:...|:.:
  Rat    78 LSCGDEHTAIVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCIKALKPEKVKLAACGRNHTLVSTD 142

  Fly   244 TRHLLHQGYALLHTQLFTFGASNNGLLGSGDHIRRANVMRLQKLDSMGVC-SIAAGLEHTVARTL 307
            |            ..::..|.:|.|.||.||...|....::.......:. .::||...:.|.|.
  Rat   143 T------------GGVYAAGGNNEGQLGLGDTDDRDTFHQIGFFTPSDIIKQLSAGANTSAALTE 195

  Fly   308 DGRLYHWGLNNHSQLG----EDVSSPMEITITENTAALPIEQNSALEATCGDYHTLLLNASGQIH 368
            ||:|:.||.|:..|:|    .:|..|.|:|:.:     ||...|     ||.||:..:...|:::
  Rat   196 DGKLFMWGDNSEGQIGLKNKSNVCIPHEVTVGK-----PISWIS-----CGYYHSAFVTTDGELY 250

  Fly   369 SL-QPAPPMRHLQQSSTYAQTLLQLQLGAAWPRQLRLLMCSGGYTL 413
            :. :|......|...........|..||.  |.::..:.|.||:|:
  Rat   251 TFGEPENGKLGLPNQLLINHRSPQRVLGI--PDKVIQVACGGGHTV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 10/46 (22%)
RCC1_2 292..321 CDD:290274 10/29 (34%)
RCC1 308..361 CDD:278826 19/56 (34%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
RpgrXP_038955861.1 ATS1 <78..368 CDD:227511 58/241 (24%)
RCC1 352..398 CDD:395335
MDN1 <625..904 CDD:227596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.