DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and tag-229

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_001021670.1 Gene:tag-229 / 3565487 WormBaseID:WBGene00044065 Length:200 Species:Caenorhabditis elegans


Alignment Length:156 Identity:28/156 - (17%)
Similarity:53/156 - (33%) Gaps:46/156 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1057 KPGNYFNNILLSLPL-----PQKTSSPLAKART-------------TTSALSKLQTEAASALDFL 1103
            ||...|..||:.:|.     |.:|.....:..:             |:|:.|:.:...:||:   
 Worm     4 KPELIFIGILILVPAQWLLSPSETGHLKYRMNSLIFTLKQYIPSFMTSSSDSEAEAAESSAI--- 65

  Fly  1104 GFPPRRIQSQEALNSKPGGLQRADSLISMGHNTSRDLDNSSLASFQLDQSLMNSTVN-------G 1161
                     ...:|.:..|      ...||..|..   .:....|::...:.::.:|       .
 Worm    66 ---------MAEMNPEGNG------AYGMGQYTRH---RAPHVEFRVGDVITHTKLNFRGVIIGW 112

  Fly  1162 DESSTFNESFSKLSHNNNNSISKHMN 1187
            ||.:...|.|.|::|..|.:.:...|
 Worm   113 DEHAIAPEKFLKVAHGENKNYATQPN 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826
RCC1_2 292..321 CDD:290274
RCC1 308..361 CDD:278826
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
tag-229NP_001021670.1 YccV-like 89..186 CDD:382598 10/50 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.