DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and Rsph1

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster


Alignment Length:320 Identity:72/320 - (22%)
Similarity:106/320 - (33%) Gaps:126/320 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   761 PDGSVYC-GELQHGIIEGFGKMVIPTTGLYVGNFKGGRFHGHGVYEMHCKDS------------- 811
            |:..:|. |....|..:|.|..::|....|.||::.||.||.|||..  ||.             
  Fly    22 PNIGLYIGGRNAAGQRQGRGWAILPNGDQYDGNYRKGRRHGIGVYVF--KDGSRYYGQYRCGKRC 84

  Fly   812 -------PESEVYEGNFCEGLFHGHGVMRNNRYIYVGEYQANARSGYGVIEDLVSGDKYMGMFAD 869
                   |:..|||||:.:.|.||.|     ||.|                  |:||.|.|.:..
  Fly    85 GRGIFIYPDGSVYEGNWRKNLKHGKG-----RYKY------------------VNGDNYSGDWFK 126

  Fly   870 NKRSGI----------GSCITNR------GDYFEGSFS---------------GDDLTGSGVAVF 903
            .:|.|:          |.|::.|      .:...|.|.               .|:|..||.|||
  Fly   127 GQRHGVGIYHFNSGKDGCCLSVRMKATWNSNMRTGPFELYIGNEDKCTILHGIWDNLYPSGPAVF 191

  Fly   904 ENDYYYEGELTLLGPNGRGEYYMPSGDACGGSGAMGTGEFDDTCELIGNKM-----------FGQ 957
            .    :.....|||      |::|:  :..........|.:|..|.:.::|           |.|
  Fly   192 S----FNNRYLLLG------YFLPA--SYNMKAISNEDEMEDAEERLEDEMGEAEPMEPTLWFAQ 244

  Fly   958 LSGTWDTVRIQAGELVLNRRFPKYPSSLGRQVVDHNRKWRSLFNNFESDLANCTASTSSS 1017
            ....:|...:           |:.|..|...               :|:|:.|:.||..|
  Fly   245 EMAVYDFSLL-----------PQEPVPLAIS---------------DSELSVCSLSTEPS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826
RCC1_2 292..321 CDD:290274
RCC1 308..361 CDD:278826
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
Rsph1NP_609609.1 MORN 51..73 CDD:280628 12/23 (52%)
MORN 72..93 CDD:197832 0/20 (0%)
MORN 95..116 CDD:197832 12/43 (28%)
MORN 118..137 CDD:197832 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.