DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and CG9135

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster


Alignment Length:331 Identity:74/331 - (22%)
Similarity:116/331 - (35%) Gaps:103/331 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 GSQELFVVLTNGSVQRQATGSGRD----VGHPHAWQTLGFDPLELHAEGVRIRRVCCSAQGVVFV 152
            |......:...|:|  .|.|..:.    ||:.||   ..:.|..::..|..|.|:.|.|:..|.:
  Fly   177 GRHHTLFLTDTGTV--YACGENKSGQCGVGNTHA---NIYSPTPINYRGPPIIRIGCGAEFSVIL 236

  Fly   153 GASGETYVMG--SCGEV----------------FKAEQQPRHMRLYEE-----------GKELLD 188
            ...|..:..|  ..|::                |..|..|:.:.||.|           |.:::|
  Fly   237 DIKGSLHTFGLPEYGQLGHNTDAKYFVNANKLSFHFETSPKKVVLYIEKSKEGHVTPVDGVQIVD 301

  Fly   189 LAAGNEHFVMLVAPYNLADDALQLSVASAKE---------------EPEDE---RASVKSISSGH 235
            .|.||.|.|               ::.|.|.               ||:||   |......:.|.
  Fly   302 FACGNNHTV---------------AIDSKKRVYSWGFGGFGRLGHAEPKDEMVPRLMKFFDTQGR 351

  Fly   236 SERSV-AANTRHLLHQGYALLHTQLFTFGASNNGLLGSGDHIRRANV--MRLQKLDSMGVCSIAA 297
            ..||| ..:|..|:.....|    ||.||.:..    :|:    ||:  ..:|.|....:..|  
  Fly   352 GGRSVFCGSTFSLIVNELGL----LFLFGQNKK----TGE----ANMYPKPVQDLSGWNITDI-- 402

  Fly   298 GLEHT-VARTLDGRLYHWGLN-NHSQLG-----EDVSSPMEITITENTAALPIEQNSALEATCGD 355
            |..:| :..:.|..|..||.: ...:||     :..:.|.|:...:| ..:|       :.|.|.
  Fly   403 GCANTSIMISADDTLIAWGASPTFGELGIGEFQKSSTVPKEVPKLDN-IKIP-------QVTMGY 459

  Fly   356 YHTLLL 361
            .||:||
  Fly   460 SHTVLL 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 12/48 (25%)
RCC1_2 292..321 CDD:290274 7/30 (23%)
RCC1 308..361 CDD:278826 14/58 (24%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
CG9135NP_001285655.1 RCC1 139..184 CDD:278826 1/6 (17%)
RCC1_2 171..200 CDD:290274 5/24 (21%)
RCC1 188..236 CDD:278826 15/52 (29%)
RCC1 239..312 CDD:278826 16/87 (18%)
RCC1 317..366 CDD:278826 11/48 (23%)
RCC1 414..465 CDD:278826 14/58 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.