DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and Rccd1

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:XP_006229517.1 Gene:Rccd1 / 308760 RGDID:1309901 Length:378 Species:Rattus norvegicus


Alignment Length:308 Identity:68/308 - (22%)
Similarity:104/308 - (33%) Gaps:111/308 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VQRQATGSGRDVGHPHAW---QTLGFDPLELH--AEGVRIRRVCCSAQGVVFVGASGETYVMGS- 163
            |||..:|||.::   .||   ..|..:||.:.  |.|.:       |||....|:...   ||: 
  Rat    86 VQRNKSGSGTEL---QAWVPGSALQGEPLWVQNLASGAK-------AQGEDEPGSEPR---MGTL 137

  Fly   164 ----CGEVFKAEQQPRHMRLYEEGKELLDLAAGNEHFVMLVAPYNLADDALQLSVASAKEEPEDE 224
                |...:...|.|....|..| ..:..|..|.||.::|                         
  Rat   138 PLLPCARAYMTPQPPFCQPLAPE-LRVRQLQLGAEHALLL------------------------- 176

  Fly   225 RASVKSISSGHSERSVAANTRHLLHQGYALLHTQLFTFGASNNGLLGSGDHIRRANVMRLQKLDS 289
                  ..:|                       |:|::|...:|.||.|..........|:.|..
  Rat   177 ------CEAG-----------------------QVFSWGGGRHGQLGHGSLEAELEPRLLEALQG 212

  Fly   290 MGVCSIAAGLEHTVARTLDGRLYHWGLNNHSQL--------------------------GE---- 324
            :.:..:|||..|:|..:..|.:|.||.|...||                          ||    
  Rat   213 LRMAEVAAGGWHSVCVSETGDIYIWGWNESGQLALPTRSGTEKKTVREEATELNDDGLRGEEAAL 277

  Fly   325 -DVSSPME-ITITENTAALPIEQNS-ALEATCGDYHTLLLNASGQIHS 369
             ||.:|.. |.|....|.|.:...| |::|:||..||.::..:|::::
  Rat   278 ADVGAPAHFIAIQPFPALLDLPLGSDAVKASCGSRHTAVVTRTGELYT 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 13/45 (29%)
RCC1_2 292..321 CDD:290274 10/28 (36%)
RCC1 308..361 CDD:278826 23/85 (27%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
Rccd1XP_006229517.1 RCC1_2 163..192 CDD:290274 9/82 (11%)
RCC1 180..228 CDD:278826 15/70 (21%)
RCC1_2 218..244 CDD:290274 10/25 (40%)
RCC1_2 305..333 CDD:290274 6/21 (29%)
RCC1 321..368 CDD:278826 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.