DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Als2 and Jph2

DIOPT Version :9

Sequence 1:	NP_649347.1	Gene:	Als2 / 40410	FlyBaseID:	FBgn0037116	Length:	1486	Species:	Drosophila melanogaster
Sequence 2:	NP_001033063.1	Gene:	Jph2 / 296345	RGDID:	1305196	Length:	692	Species:	Rattus norvegicus

Alignment Length:	143	Identity:	43/143 - (30%)
Similarity:	65/143 - (45%)	Gaps:	7/143 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   759 EYPDGSVYCGELQHGIIEGFGKMVIPT-TGLYVGNFKGGRFHGHGVYEMHCKDSPESEVYEGNFC 822
            ::.||..|||..:.|...|.|....|. .|.|.|::..| |...|||..     |....:||.:.
  Rat     7 DFDDGGAYCGGWEGGKAHGHGLCTGPKGQGEYSGSWNFG-FEVAGVYTW-----PSGNTFEGYWS 65

  Fly   823 EGLFHGHGVMRNNRYIYVGEYQANARSGYGVIEDLVSGDKYMGMFADNKRSGIGSCITNRGDYFE 887
            :|..||.|:....|::|.||:....:..||:.:...||.||.|.:.:..:.|.|:.....|..::
  Rat    66 QGKRHGLGIETKGRWLYKGEWTHGFKGRYGIRQSTNSGAKYEGTWNNGLQDGYGTETYADGGTYQ 130

  Fly   888 GSFSGDDLTGSGV 900
            |.|:.....|.||
  Rat   131 GQFTNGMRHGYGV 143

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Als2	NP_649347.1	RCC1	258..304	CDD:278826
		RCC1_2	292..321	CDD:290274
		RCC1	308..361	CDD:278826
		PH-like	616..715	CDD:302622
		VPS9	1373..1479	CDD:280383
Jph2	NP_001033063.1	MORN 1. /evidence=ECO:0000255	14..36		7/21 (33%)
		MORN 2. /evidence=ECO:0000255	38..59		8/26 (31%)
		MORN 3. /evidence=ECO:0000255	60..79		6/18 (33%)
		MORN 4. /evidence=ECO:0000255	82..104		6/21 (29%)
		MORN	106..128	CDD:280628	5/21 (24%)
		MORN 5. /evidence=ECO:0000255	106..128		5/21 (24%)
		MORN 6. /evidence=ECO:0000255	129..151		5/15 (33%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	164..190
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	246..273
		MORN 7. /evidence=ECO:0000255	285..307
		MORN	307..327	CDD:197832
		MORN 8. /evidence=ECO:0000255	308..330
		Bipartite nuclear localization signal. /evidence=ECO:0000250\|UniProtKB:Q9ET78	345..359
		Vinculin	<413..>497	CDD:279395
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	439..661
		Nuclear localization signal. /evidence=ECO:0000250\|UniProtKB:Q9ET78	488..492
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4642
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810