DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and Rcbtb2

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:XP_038949091.1 Gene:Rcbtb2 / 290363 RGDID:735048 Length:585 Species:Rattus norvegicus


Alignment Length:335 Identity:71/335 - (21%)
Similarity:128/335 - (38%) Gaps:92/335 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 DLQLLRTDVV------DMDFCSGSQELFVVLTNGSVQRQATGSGRDVGHPHAWQTLGFDPLELHA 134
            :|||:|...|      ::.:.:.:.|:||:.||.|                  ..||...::...
  Rat    75 ELQLIRQACVFGTAGNEVLYTTVNDEIFVLGTNCS------------------GCLGVGDIQSTI 121

  Fly   135 EGVRI-----RRVCCSAQG----VVFVGASGETYVMGSCGEVFKAEQQ-----------PRHMRL 179
            |..|:     :::...:.|    :|.....||.:..|     ..|..|           |.|:..
  Rat   122 EPRRLDSLTGKKIASLSYGSGPHIVLATTDGEVFTWG-----HNAYSQLGNGTTNHGLVPCHIST 181

  Fly   180 YEEGKELLDLAAGNEHFVMLVAP-------YNLADDALQLSVASAKEEPEDERAS-------VKS 230
            ....|:::::|.|:.|.::|.:.       ||   ::.|:...|...:|...|.:       |.|
  Rat   182 NLSNKQVIEVACGSYHSLVLTSDGEVFAWGYN---NSGQVGSGSTANQPIPRRVTGCLQNKVVMS 243

  Fly   231 ISSGHSERSVAANTRHLLHQGYALLHTQLFTFGASNNGLLGSGDHIRRANVMRLQKLDSMGVCSI 295
            |:.|........:|            .:::.:|.:.||.||.|....:....|:..|..:.|..:
  Rat   244 IACGQMCSMAVVDT------------GEVYVWGYNGNGQLGLGSSGNQPTPCRVAALQGIRVQRV 296

  Fly   296 AAGLEHTVARTLDGRLYHWGLNNHSQLG----EDVSSPMEITITENTAALPIEQNSALE-ATCGD 355
            |.|..||:..|.:|::|.||.|::.|||    .:.|.|..:.         :|::..:| |.|..
  Rat   297 ACGYAHTLVLTDEGQIYAWGANSYGQLGTGNKSNQSYPTPVV---------VEKDRIIEIAACHS 352

  Fly   356 YHTLLLNASG 365
            .||....:.|
  Rat   353 AHTSAAKSQG 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 13/45 (29%)
RCC1_2 292..321 CDD:290274 11/28 (39%)
RCC1 308..361 CDD:278826 16/57 (28%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
Rcbtb2XP_038949091.1 ATS1 <141..421 CDD:227511 55/251 (22%)
BTB_POZ_RCBTB2_CHC1L 408..524 CDD:349663
BACK_RCBTB2 521..585 CDD:350604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.