DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and Rccd1

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_775621.2 Gene:Rccd1 / 269955 MGIID:2444156 Length:377 Species:Mus musculus


Alignment Length:336 Identity:78/336 - (23%)
Similarity:120/336 - (35%) Gaps:104/336 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 QATGSGRDVGHPHAWQTLGFDPLELHAEGVRIRRVCCSAQG---VVFVGASGETYVMGS------ 163
            ||.|||.  .|...     :.|..|||..    .:|..:.|   ...|...|...:.||      
Mouse    19 QALGSGN--SHHSV-----YSPEPLHASD----DICQVSAGWSYTALVTRGGRVELSGSVSGAAD 72

  Fly   164 -CGEVFKAEQQPRHMRLYEEGKELLDL---AAGNEHFVMLVAPYN-LADDAL--QLSVASAKEEP 221
             |.:|:.:|             |||.|   ..|:...|....|.: |..:.|  |..|:.||.:.
Mouse    73 GCRDVWASE-------------ELLVLLRNKGGSSTEVQAWVPGSALQGEPLWVQNLVSGAKGQG 124

  Fly   222 EDE----------------RASV-------KSISSGHSERSVAANTRHLLHQGYALLHT--QLFT 261
            |||                ||.|       :.::.....|.:.....|:|     ||..  |:|:
Mouse   125 EDEPSRESRMGTLPLLPCARAYVTPEPPFCQPLAPELRVRQLELGAEHVL-----LLCAAGQVFS 184

  Fly   262 FGASNNGLLGSGDHIRRANVMRLQKLDSMGVCSIAAGLEHTVARTLDGRLYHWGLNNHSQLG--- 323
            :||..:|.||.|..........|:.|..:.:..:|||..|:|..:..|.:|.||.|...||.   
Mouse   185 WGAGRHGQLGHGTLEAELEPRLLEALQGLRMAKVAAGGWHSVCLSETGDIYIWGWNESGQLALPT 249

  Fly   324 ----------EDVSSPMEITITENTAA--------------------LPIEQNSALEATCGDYHT 358
                      |:.:...|..:.|..|.                    ||: .:.|:.|:||..||
Mouse   250 RSGTENKAEREEATELNEDGLKEELAVADAGAPAHFIAIQPFPALLDLPL-GSDAVMASCGSRHT 313

  Fly   359 LLLNASGQIHS 369
            .::..:|::::
Mouse   314 AVVTRTGELYT 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 14/45 (31%)
RCC1_2 292..321 CDD:290274 10/28 (36%)
RCC1 308..361 CDD:278826 19/85 (22%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
Rccd1NP_775621.2 Interaction with KDM8. /evidence=ECO:0000250|UniProtKB:A6NED2 1..172 39/176 (22%)
ATS1 <159..341 CDD:227511 40/172 (23%)
RCC1 2 179..230 15/50 (30%)
RCC1 3 232..289 11/56 (20%)
RCC1 4 319..372 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.